KEGG   Mus musculus (mouse): 210973
Entry
210973            CDS       T01002                                 

Symbol
Kbtbd2, BC022962, Bklhd1, mKIAA1489
Name
(RefSeq) kelch repeat and BTB (POZ) domain containing 2
  KO
K10470  kelch repeat and BTB domain-containing protein 2
Organism
mmu  Mus musculus (mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:mmu04121]
    210973 (Kbtbd2)
Ubiquitin system [BR:mmu04121]
 Ubiquitin ligases (E3)
  Multi subunit Ring-finger type E3
   Cul3 complex
    Adoptor and target recognizing subunit (BTB)
     210973 (Kbtbd2)
SSDB
Motif
Pfam: BACK BTB Kelch_6 Kelch_1 Kelch_2 Kelch_4 Kelch_3 Kelch_5
Other DBs
NCBI-GeneID: 210973
NCBI-ProteinID: NP_001349138
MGI: 2384811
Ensembl: ENSMUSG00000059486
Vega: OTTMUSG00000057740
Position
6:complement(56754510..56774798)
AA seq 623 aa
MSTQEERQINTEYAVSLLEQLKLFYEQQLFTDIVLIVEGTEFPCHKMVLATCSSYFRAMF
MSGLSESKQTHVHLRNVDAAALQMIIAYAYTGNLAVNDSTVEQLYETACFLQVEDVLQRC
REYLIKKINAENCVRLLSFADLFSCEELKQSAKRMVEHKFTAVYRQEAFMQLSHDLLIDI
LSSDNLNVEKEETVREAAMLWLEYNTESRSQYLSSVLSQIRIDALSEVTQRAWFQGLPPN
DKSVVVQGLYKSMPKFFKPRLGMTKEEMMIFIEASSENPCSLYSSVCYSPQAEKVYKLCS
PPADLHKVGTVVTPDNDIYIAGGQVPLKNTKTNHSKTSKLQTAFRTVNCFYWFDAQQNTW
FPKTPMLFVRVKPSLVCCEGYIYAIGGDSVGGELNRRTVERYDTEKDEWTMVSPLPCAWQ
WSAAVVVHDCIYVMTLNLMYCYFPRSDSWVEMAMRQTSRSFASAAAFGDKIFYIGGLHIA
TNSGIRLPSGTVDGSSVTVEIYDVNKNEWKMAANIPAKRYSDPCVRAVVISNSLCVFMRE
THLNERAKYVTYQYDLELDRWSLRQHISERVLWDLGRDFRCTVGKLYPSCLEESPWKPPT
YLFSPDGTEEFELDGEMVALPPV
NT seq 1872 nt   +upstreamnt  +downstreamnt
atgtccactcaagaggaaaggcagatcaataccgaatatgctgtgtccttattggaacag
ttgaaactgttttatgaacaacagttatttactgacatagtgttaattgttgagggcact
gaattcccttgtcataagatggttcttgcaacatgtagctcctatttcagggccatgttc
atgagtggactaagtgaaagcaagcagacacatgtacacctgaggaatgtggacgctgcc
gccttgcagatgataatagcttacgcgtacacagggaacttggcagtaaacgacagcact
gtggagcagctctatgaaacagcttgcttcctgcaggtagaagatgtgttacagcgttgc
cgagaatatttaattaaaaaaattaatgcagagaactgtgtgcggctgctgagttttgct
gacctcttcagttgtgaagaattaaagcagagtgcaaagaggatggtggagcacaagttc
acggctgtgtaccgccaggaagccttcatgcagctgtcccacgacctcctcatagacatc
ctcagcagcgacaacttaaatgtagaaaaggaggaaaccgtgcgagaggctgccatgctc
tggctagagtacaacacagagtcacgatcccagtatttgtcttcagttcttagccagatc
agaattgatgctctttcagaagtcacacaaagagcttggtttcaaggtctcccacccaac
gataagtctgttgtggttcagggtctttataagtctatgcccaagttcttcaaacccaga
cttgggatgactaaggaggaaatgatgattttcattgaagcatcctcagaaaacccttgt
agtctttactcttctgtctgttatagcccccaggcagaaaaagtttacaagttatgcagc
ccacccgctgatttgcataaggttgggacagttgtaactccggataatgatatttacata
gcagggggccaagtgcccttgaaaaacacaaaaacaaatcacagtaaaacaagtaaactg
cagactgccttccgaactgtgaattgcttttactggtttgatgcacaacaaaatacctgg
tttccaaagacaccaatgctttttgtccgtgtgaagccatctttggtttgctgtgaaggc
tatatctatgcaatcggaggagatagtgttggtggagaacttaaccggaggactgtagaa
agatacgacactgagaaggatgagtggacaatggtgagccctttgccttgtgcatggcag
tggagtgcagcagttgtagttcacgactgcatctatgtgatgacattaaacctcatgtac
tgttactttccaagatctgactcatgggtagaaatggccatgaggcagactagcagatct
tttgcttcagctgcagcttttggtgataaaattttctatattggagggttgcatattgct
accaattctggcataagactcccctctggcactgtagatgggtcttcagtaactgtggaa
atttatgatgtgaataaaaatgaatggaagatggctgccaacatccctgctaaaaggtat
tctgatccctgtgttagagctgttgtgatctcaaattctctttgtgtgtttatgcgagaa
acccacttaaatgaacgagctaagtatgtcacctaccagtatgatttggaacttgaccgg
tggtctctgcggcagcatatatctgaacgtgtactgtgggacctagggagagattttcgg
tgcactgtggggaaactttatccatcctgtcttgaagaatctccatggaagccaccaact
taccttttttcaccagatggaacagaggagtttgaactggatggggaaatggttgcactt
ccgcctgtatag

DBGET integrated database retrieval system