KEGG   Mus musculus (mouse): 210982
Entry
210982            CDS       T01002                                 

Gene name
Bicral, Glts, Gltscr1l, mKIAA0240
Definition
(RefSeq) BRD4 interacting chromatin remodeling complex associated protein like
Organism
mmu  Mus musculus (mouse)
SSDB
Motif
Pfam: GLTSCR1
Other DBs
NCBI-GeneID: 210982
NCBI-ProteinID: NP_001093922
MGI: 2673855
Ensembl: ENSMUSG00000036568
UniProt: Q8CHH5 B2RX81
Position
17; 17 C
AA seq 1074 aa
MDDDDDSCLLDLIGDPQALNYFLHGPSSKSGSDDVTNAGYSAANSNSIFANSTNADPKSA
LKGVSDQLGEGPSDGLPLASSLQFLEDELESSPLPDLSEDQPFDILQKSLQEANITEQTL
AEEAYLDASIGSSQQFAQAQLHPSSSASFTQASNVSNYSGQTLQPIGVTHVPVGASFASN
TVGVQHGFMQHVGISVPSQHLPNSSQISGSGQIQLIGSFGNQPSMMTINNLDGSQIILKG
SGQQAPSNVSGGLLVHRQTPNGNSLFGNSTSSPVAQPVTVPFNSTNFQASLPVHNIIIQR
GLAPNSNKVPINIQPKPVQMGQQSAYNVNNLGIQQHHAQQGISFAPTSSPQGSVVGPHMS
VNIVNQQNTRKPVTSQAVSGTGGSIVIHSPMGQPHTPQSQFLIPTSLSVSSNSVHHVQAI
NGQLLQTQPSQLISGQVASEHVMLNRNSSNMLRTNQPYSGQMLNNQNTAVQLVSGQTFAT
SGSPVIVNHASPQIVGGQMPLQQASPTVLHLSPGQSSVSQGRPGFATMPAVSGMAGPARF
PAVSSASTAHPTLGPTVQSGAPGSNFTGDQLTQANRTPAPVSVSHRLPVSASKSPSTLSN
TPGTQQQFFCQAQKKCLNQTSPIPTSKTTDGLRPSQIPGLLSTALPGQDSGSKIMPATLG
ATQAQPESSVGSSPSQTAVQVDSHPGQKRPAAKQLTKGAFILQQLQRDQAHAVTPDKSQF
RSLNDTVQRLLSYHVCQGSMPTEEDLRQVDNEFEEVATQLLKRTQAMLNKYRFLLLEDAM
RINPSAEMVMIDRMFNQEERASLSRDKRLALVDPEGFQADFCCSFKLDEAVPETPLDRSD
QHRSKTSSLHQVPRAQSRDRAKPGMAEATNHDQFHLVPNHIVVSAEGNISKKSEGHSRTL
KFDRGVLGQYRGPPEDKGGRRDPAKVSRCSPGPEGHRKSLPRPDHGSESKLPGVLASSHM
EMPCLDSFQDKALRNSPKNEVLHTDIMKGSGEPQPDLQLTKSLEKTFKNILELKNSGRPP
SDPTASGAADLDFPSFSPMASQENCLEKFIPDHSEGVVETDSILEAAVNSILEC
NT seq 3225 nt   +upstreamnt  +downstreamnt
atggatgatgacgatgactcctgtctcctcgatcttattggagacccacaagcattgaac
tattttctgcacggacctagcagtaaatcgggcagcgatgatgtgacgaacgcagggtat
tctgcagccaattctaattcaattttcgccaactccacgaacgctgaccctaaatcggcc
ctcaaaggtgtgagtgaccagcttggggaggggcccagtgatgggctgccgcttgcaagc
agccttcagtttcttgaagatgaacttgagtcttcacctctccccgatctcagcgaggac
caaccctttgacattcttcagaaatccttgcaggaggctaatatcactgaacagacattg
gcagaagaggcgtacctggatgccagtataggctcaagccaacagtttgcacaagcccag
cttcatccttcttcatcagcatcctttactcaggcttctaatgtttctaattactcaggt
cagacactgcagcctatcggggtgactcacgtgcctgttggagcatcgtttgcaagcaat
acagtgggtgtgcagcatggctttatgcaacacgtggggatcagtgttcccagccagcat
ttgcctaacagcagccagattagtggctccggtcagatacagttaatcgggtccttcggt
aatcagccttccatgatgactataaataacctcgatggctctcaaatcatactgaaaggc
agtgggcagcaagccccatctaatgtgagtggggggcttctggttcacagacagactcct
aacggcaactctctgtttgggaactccacttccagtcctgtagcacagcctgtcaccgtt
ccatttaacagcacaaatttccaggcatctttacccgtgcataacatcattattcaaagg
ggtcttgcaccaaattcaaataaagtcccaattaatatccagccaaagccggtccagatg
ggtcagcagagcgcgtacaatgtgaacaaccttgggatccagcagcaccatgcccagcag
gggatctccttcgcccccacaagctcgccccagggctccgtggttgggccgcacatgtct
gtgaacattgtcaaccaacagaacacgagaaagcctgtcacctcgcaggcagtgagcggc
acagggggcagcatcgtcatccattcccccatgggccagcctcacactccccaaagtcag
ttccttatacccacaagcctttctgtcagctccaactcggtgcaccatgtccaggctata
aacgggcagctgcttcagactcagccctcccagctcatctctggccaagtggcctctgag
catgtcatgctgaacaggaattcctctaacatgctcaggaccaaccaaccatattccgga
cagatgcttaataaccagaataccgccgtccagctggtgtctgggcagacttttgccacc
tctggaagtccagtgatagtcaaccacgcctctcctcagatcgtcgggggacagatgccc
ttgcagcaggcctcacccaccgtgttacacctgtcacctgggcagagcagtgtttcccag
ggaaggccaggcttcgccaccatgcccgcggtgagcggcatggcaggacccgctcggttc
cccgccgtcagctcagctagcactgctcatcctactcttgggcctacggtgcagtcgggg
gcaccgggatcaaactttacgggagaccagctgacacaagccaacagaacgccagcgccc
gtcagtgtgtcccaccgtcttccagtctctgcttccaaatcccccagcaccttgagcaac
accccggggacacagcagcagttcttctgtcaggctcagaagaagtgtttgaaccagacc
tcccccattcccacatccaagaccacagacggcttgaggccatcacagatccctgggctc
ttgagcaccgcactgccaggacaggattctggaagcaaaattatgccagcgaccttgggg
gccacacaggcacaaccagaaagctcagttggatcatccccgagccagacagctgtgcag
gtggatagtcatccaggacagaaaaggcctgctgccaaacagctgactaaaggagctttc
atcctccagcagttacagagggaccaagcccatgctgtgacacccgacaaaagccagttc
cggtcactaaatgacacggtgcagagactgctctcctaccacgtgtgccagggctccatg
cccacggaggaagacctgaggcaagtggacaatgaatttgaagaggtcgccactcagctc
ctcaaaaggacccaagctatgctgaacaaatacagattcctgctcctagaagacgccatg
aggatcaacccctctgcagagatggtgatgattgacaggatgttcaaccaggaggaaaga
gcttccctgtcgagggacaagcgtctggcgctcgtagatcctgagggttttcaggccgat
ttctgttgttccttcaaacttgacgaagctgtacctgagaccccgcttgacaggagtgac
cagcatcgcagcaaaaccagctcgctccatcaggtgcccagggcccaaagcagagaccga
gccaagccaggcatggcagaagcaacgaatcatgaccagtttcatctagtgcctaaccac
atcgtggtctctgcagagggaaacatttctaaaaagtcagaaggccacagtagaacactg
aaatttgacagaggggtcttaggccaataccggggtccgcctgaggacaagggcggccgg
agggaccctgccaaggtcagcaggtgctctccgggccccgagggccaccgcaaaagcttg
cccaggccagatcacggctctgagagcaagctccccggcgtcctggccagctcgcacatg
gagatgccctgtctcgactccttccaggacaaagcgctgaggaattccccaaagaatgag
gttttacacacagacatcatgaaagggtcgggtgagccccagccagatctccagctcacc
aagagcctagagaaaacctttaagaacatcctggaactcaagaactcggggcggccgcca
agcgaccctacggccagcggtgcggcggacctggacttccccagcttttctccaatggct
tcgcaggaaaactgcctagaaaaattcatcccggaccacagtgaaggcgttgtagaaacg
gactccattttagaagcagctgtaaatagtattctagagtgttaa

DBGET integrated database retrieval system