KEGG   Mus musculus (mouse): 211147Help
Entry
211147            CDS       T01002                                 

Gene name
Marchf11, 9630025C22, March11
Definition
(RefSeq) membrane associated ring-CH-type finger 11
  KO
K10659  E3 ubiquitin-protein ligase MARCH4/9/11 [EC:2.3.2.27]
Organism
mmu  Mus musculus (mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:mmu04121]
    211147 (Marchf11)
Enzymes [BR:mmu01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.27  RING-type E3 ubiquitin transferase
     211147 (Marchf11)
Ubiquitin system [BR:mmu04121]
 Ubiquitin ligases (E3)
  Single Ring-finger type E3
   March proteins
    211147 (Marchf11)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: RINGv ABC_cobalt
Motif
Other DBs
NCBI-GeneID: 211147
NCBI-ProteinID: NP_808265
MGI: 3608327
Ensembl: ENSMUSG00000022269
Vega: OTTMUSG00000032749
UniProt: Q8CBH7
Position
15; 15 B1
AA seq 400 aa AA seqDB search
MSDEGKKRSSRADSLEAEPPLPPPPPPPPPGESVLVPTSPRYRPPLPAPLERIVGSGEPP
VELAPRRKGAGEPLPPLPPSLLPGDQEVTAAGDSCEGPRRLPEVKLPEAATGKGSPGEPE
AGACREGERRGTGDQPETRSVCSSRSSSSGGGSDQRSGHQHQHHQPICKICFQGAEQGEL
LNPCRCDGSVRYTHQLCLLKWISERGSWTCELCCYRYHVTAIKMKQPCQWQSISITLVEK
VQMIAVILGSLFLIASVTWLLWSAFSPYAVWQRKDILFQICYGMYGFMDLVCIGLIVHEG
AAVYRVFKRWRAVNLHWDVLNYDKATDIEESSRGESSTSRTLWLPLSALRNRNLVHPTQL
TSPRFQCGYVLLHLFNRMRAHEDVSEDNGSGEVVMRVTSV
NT seq 1203 nt NT seq  +upstreamnt  +downstreamnt
atgagcgacgagggcaaaaaacggtctagccgggcggacagcctcgaagctgagccacct
ctgcccccgccgcccccacccccgcctccgggagagtcggtcctggtccccacctcccca
cgctaccggccgccgctgcccgcgcctctggagcgcatcgtagggtcgggcgagccgccg
gtagaactggcccctcggcgcaagggcgcaggagagcctctaccgccgctgccgccgtct
ctgttgcccggcgaccaggaggtgacagcggcgggcgactcctgcgaaggtcctaggcgc
cttccagaggtgaagctccccgaggctgcgacggggaaaggcagcccgggggagcccgag
gccggcgcgtgccgggagggcgagcggcgaggcaccggagaccagcccgaaacacgctcc
gtatgtagcagccgcagcagcagtagtggcggcggtagcgaccagcgctcggggcaccag
caccagcaccatcagcccatttgcaagatctgcttccagggcgcagagcagggtgagttg
ttaaatccttgccgatgtgatgggtctgttcgatacacacatcagctgtgtcttctaaag
tggatcagtgagagaggctcctggacctgcgagctgtgctgttatagataccacgtcaca
gccattaaaatgaagcaaccttgccagtggcagagcatttctataacactggttgagaaa
gttcagatgatcgctgtaatcctaggatccctgttcttaatagcgagtgtgacttggctc
ctctggtcagccttcagcccctatgcagtgtggcagaggaaggacatcctttttcaaatc
tgctatggaatgtatggttttatggatctagtgtgcataggcctcattgtgcatgaagga
gctgccgtttacagagtgtttaagcgatggcgagctgttaatttgcactgggatgtgtta
aattatgacaaagccacagacattgaagaaagcagccgaggagagtcttccacaagtagg
actttgtggctaccattgtcagctctgaggaacaggaacttggtccacccaacgcaacta
acctcaccacggtttcagtgtggctatgtgctattacatctattcaatcggatgagggcc
catgaagatgtatcggaagataacggctctggggaggtagtgatgagagtgacgtctgtg
tga

DBGET integrated database retrieval system