KEGG   Mus musculus (house mouse): 211255
Entry
211255            CDS       T01002                                 
Symbol
Kbtbd7, 1110008P08Rik, AU045792, Gm295
Name
(RefSeq) kelch repeat and BTB (POZ) domain containing 7
  KO
K10474  kelch repeat and BTB domain-containing protein 6/7
Organism
mmu  Mus musculus (house mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:mmu04121]
    211255 (Kbtbd7)
Ubiquitin system [BR:mmu04121]
 Ubiquitin ligases (E3)
  Multi subunit Ring-finger type E3
   Cul3 complex
    Adoptor and target recognizing subunit (BTB)
     211255 (Kbtbd7)
SSDB
Motif
Pfam: BTB BACK Kelch_1 Kelch_6 Kelch_3 Kelch_4 Kelch_2 KBTB_W-LIR SANBR_BTB PT-TG
Other DBs
NCBI-GeneID: 211255
NCBI-ProteinID: NP_001019306
MGI: 2685141
Ensembl: ENSMUSG00000043881
UniProt: Q501K2 G5E8C2
Position
14:79663951..79668479
AA seq 690 aa
MQSREDAPRSRRLASPRGGRRPKRISKPSVSAFFTGPEELKDAAHSAALLAQLKSFYDAR
LLCDVTIEVVTPGSGPGTGRLFSCNRNVLAAACPYFKSMFTGGMYESQQASVTIHDVDAE
SFEVLVDYCYTGRVSLSEANVQRLYAASDMLQLEYVREACASFLARRLDLTNCTAILKFA
DAFDHHKLRSQAQSFIAHNFKQLSRMGSIREETLADLTLAQLLAVLRLDSLDVESEKTVC
HVAVQWLEAAPKERGPSAAEVFKCIRWAHFPAEEQDYLGGLLSKPIVKKYCLDIIEGALR
QLRFGDRLYKSVVAKPNSSHSSDSNNSSNSSSSSSSVVSVAENPPQRLGMCAKEMVIFFG
HPRDPFLCYDPYSGDIYTMPSPLTSLAHTKTITSSAVCVSPDHDIYLAAQPRKDLWVYKP
AQNSWHQLADRLLCREGMDVAYLNGYIYILGGRDPITGVKLKEVECYSVQRNQWALVAPV
PHSFYSFELIVVQNYLYAVNSKRMLCYDPSHNMWLNCASLKRSDFQEACVFKEEIYCICD
IPVMKVYNPARGEWRRISNIPLDSETHNYQIVNHDQKLLLITSTTPQWKKNRVTVYEYDT
REDQWINIGTMLGLLQFDSGFICLCDRVYPSCLEPGQSFITEEDDARSESSTEWDLDGFS
ELDSESGSSSSFSDDEVWVQVAPQRNAPDQ
NT seq 2073 nt   +upstreamnt  +downstreamnt
atgcagtcccgggaagacgccccgcgctctcgccgcctcgccagcccccgcggcgggagg
cggcccaagaggatttccaagccctcggtgtcggcctttttcacgggcccggaggaatta
aaggacgcggcccattccgcagccctcctggcacagctcaagtctttctacgacgcgcgg
ctgctgtgcgatgtgaccatcgaggtggtgacgcctggcagcgggccgggcacggggcgc
ctcttctcgtgcaaccgcaacgtgctggcggccgcttgcccctacttcaagagcatgttc
acggggggcatgtacgagagccagcaggccagcgtgacgatccacgacgtggatgccgag
tccttcgaggtcttggtggactactgctacactggtcgcgtgtcgctcagcgaggccaac
gtgcagcgcctgtacgcggcctcggatatgctgcagctggagtacgtgcgcgaagcctgt
gcctccttcctggctcgccgccttgacctgaccaattgcactgccatcctcaagtttgcc
gatgcctttgaccaccacaagctgcgatctcaggcccagtccttcatagctcacaacttc
aagcagctcagcaggatggggtccattcgggaggagacgctggcagatctgaccctggcc
cagctgctggccgtcctgcgtctggacagcttggatgtagagagtgagaagactgtgtgt
catgtggcggtgcagtggctggaggctgctccgaaagagcggggtcccagtgctgcggaa
gtctttaagtgtattcgttgggcgcacttccctgcagaagagcaggactacctgggaggg
ctactgagcaagcctattgtgaagaaatactgcctggacattattgaaggggctctccgg
cagctgcgatttggtgataggttgtacaagtcagtggttgccaagccaaatagcagccac
agcagtgatagcaataatagcagcaatagcagcagcagcagtagctcagttgtatcggta
gcagaaaatccaccccaaaggttgggtatgtgtgccaaagagatggtaatattttttggg
cacccccgagatccatttctctgttacgacccttattccggagatatttacacaatgccg
tctcctttgactagcttggcacacactaagaccattacatcttcagctgtttgtgtctct
ccagaccatgacatctatcttgctgcccagcccaggaaagacctatgggtgtataaacca
gcccaaaatagttggcatcagctggcagaccgcttgctgtgtcgagagggtatggatgta
gcctatctgaatggctacatttacatcttgggtgggagagacccgattactggagttaaa
ttgaaggaagtggaatgctacagtgtccagaggaaccaatgggcattggtggctcctgta
ccacattccttttattcatttgaactaatagtggttcagaattatctttacgctgtcaac
agtaagcgcatgctctgctatgatcctagccataatatgtggctgaattgtgcatctctc
aaacgaagtgactttcaagaagcctgtgtcttcaaagaggaaatctattgtatctgtgac
atcccagtcatgaaggtctacaaccctgctagaggagagtggaggcggattagtaatatc
ccactggactcagaaacccacaactaccagattgtcaatcatgaccaaaagttgctgctc
atcacctctaccaccccacagtggaaaaagaaccgagtcacagtatatgagtatgatact
agggaagaccaatggattaatataggcaccatgttaggccttttgcagtttgactctggc
tttatttgcctgtgtgatcgagtttatccttcctgtcttgaacctggtcagagtttcatc
actgaggaagatgatgcaaggagtgagtctagcactgaatgggacttagatggattcagt
gaactggactctgagtcaggaagttcaagttctttttctgatgatgaagtctgggtacaa
gttgcgcctcagcgaaatgcaccagatcagtag

DBGET integrated database retrieval system