KEGG   Mus musculus (house mouse): 211347
Entry
211347            CDS       T01002                                 
Symbol
Pank3
Name
(RefSeq) pantothenate kinase 3
  KO
K09680  type II pantothenate kinase [EC:2.7.1.33]
Organism
mmu  Mus musculus (house mouse)
Pathway
mmu00770  Pantothenate and CoA biosynthesis
mmu01100  Metabolic pathways
mmu01240  Biosynthesis of cofactors
Module
mmu_M00120  Coenzyme A biosynthesis, pantothenate => CoA
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00770 Pantothenate and CoA biosynthesis
    211347 (Pank3)
Enzymes [BR:mmu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.33  pantothenate kinase
     211347 (Pank3)
SSDB
Motif
Pfam: Fumble
Other DBs
NCBI-GeneID: 211347
NCBI-ProteinID: NP_666074
MGI: 2387464
Ensembl: ENSMUSG00000018846
UniProt: Q8R2W9 Q5SXA7
Position
11:35660322..35682112
AA seq 370 aa
MKIKDAKKPSFPWFGMDIGGTLVKLSYFEPIDITAEEEQEEVESLKSIRKYLTSNVAYGS
TGIRDVHLELKDLTLFGRRGNLHFIRFPTQDLPTFIQMGRDKNFSTLQTVLSATGGGAYK
FEKDFRTIGNLHLHKLDELDCLVKGLLYIDSVSFNGQAECYYFANASEPERCQKMPFNLD
DPYPLLVVNIGSGVSILAVHSKDNYKRVTGTSLGGGTFLGLCSLLTGCESFEEALEMASK
GDSTQADRLVRDIYGGDYERFGLPGWAVASSFGNMIYKEKRETVSKEDLARATLVTITNN
IGSVARMCAVNEKINRVVFVGNFLRVNTLSMKLLAYALDYWSKGQLKALFLEHEGYFGAV
GALLGLPNFS
NT seq 1113 nt   +upstreamnt  +downstreamnt
atgaagatcaaggatgccaaaaaaccctctttcccatggtttggcatggacattggagga
acgctagtaaagctctcatactttgaacctattgacatcacagcagaggaagaacaagag
gaagttgagagcttaaagagtattcggaaatacttgacttctaatgtagcatatggatct
actggcattcgggatgtacatcttgagctgaaggatttaacactttttggacgaagagga
aacttgcactttatcagatttccaacccaggacctgcctacttttatccaaatggggaga
gataaaaatttctcaaccttacaaacggtgctgagtgctacaggaggtggtgcttacaag
tttgagaaagattttcgcacaattggaaacctccacctgcacaaactggatgaacttgac
tgccttgtaaagggcttgctgtacatagattccgtcagtttcaatggacaagcagaatgc
tattattttgctaatgcctcagaacccgagcgatgccaaaagatgccttttaacctggat
gatccttacccactgctggtagtgaatattggctcaggagtcagtattttagcagtccat
tccaaagacaactataaaagagtgactgggacaagccttggagggggcacctttcttggt
ttatgcagtttgttgactggctgtgaaagttttgaagaggctctggaaatggcatccaaa
ggtgacagcacccaagctgataggttggtccgagatatttatggaggagattatgaaaga
tttggtctgccaggttgggcggtggcatctagttttggtaatatgatttataaggagaaa
cgagaaactgttagtaaagaggatctggcaagagctactttagttactatcaccaataac
attggttctgtggcacgaatgtgtgctgttaatgagaaaataaatcgagttgtcttcgtt
gggaactttttacgtgtcaatactctctcgatgaaactgttggcatatgctttggattac
tggtcaaagggtcaactgaaagcattgtttttagaacatgagggatactttggagctgtt
ggtgcgcttcttggactgccgaatttcagctaa

DBGET integrated database retrieval system