KEGG   Mus musculus (mouse): 211468
Entry
211468            CDS       T01002                                 

Symbol
Kcnh8, C130090D05Rik, ELK, ELK1, ELK3, Kv12.1
Name
(RefSeq) potassium voltage-gated channel, subfamily H (eag-related), member 8
  KO
K04911  potassium voltage-gated channel Eag-related subfamily H member 8
Organism
mmu  Mus musculus (mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:mmu04040]
    211468 (Kcnh8)
Ion channels [BR:mmu04040]
 Voltage-gated cation channels
  Potassium channel, voltage-gated (Kv)
   211468 (Kcnh8)
SSDB
Motif
Pfam: Ion_trans PAS_9 Ion_trans_2 cNMP_binding PAS_3 PAS_4 PAS SlyX DUF5798 DUF5660
Other DBs
NCBI-GeneID: 211468
NCBI-ProteinID: NP_001026981
MGI: 2445160
Ensembl: ENSMUSG00000035580
Vega: OTTMUSG00000044933
UniProt: P59111 F6TUN6
Position
17; 17 C
AA seq 1102 aa
MPVMKGLLAPQNTFLDTIATRFDGTHSNFILANAQVAKGFPIVYCSDGFCELAGFARTEV
MQKSCSCKFLFGVETNEQLMLQIEKSLEEKVEFKGEIMFYKKNGAPFWCLLDIVPIKNEK
GDVVLFLASFKDITDTKVKITSEDKKEDRTKGRSRAGSHFDSARRRSRAVLYHISGHLQR
REKNKLKINNNVFVDKPAFPEYKVSDAKKSKFILLHFSTFKAGWDWLILLATFYVAVTVP
YNVCFIGNEDLSTTRSTTVSDIAVEILFIIDIILNFRTTYVSKSGQVIFEARSICIHYVT
TWFIIDLIAALPFDLLYAFNVTVVSLVHLLKTVRLLRLLRLLQKLDRYSQHSTIVLTLLM
SMFALLAHWMACIWYVIGKMEREDNSLLKWEVGWLHELGKRLESPYYGNNTLGGPSIRSA
YIAALYFTLSSLTSVGFGNVSANTDAEKIFSICTMLIGALMHALVFGNVTAIIQRMYSRW
SLYHTRTKDLKDFIRVHHLPQQLKQRMLEYFQTTWSVNNGIDSNELLKDFPDELRSDITM
HLNKEILQLSLFECASRGCLRSLSLHIKTSFCAPGEYLLRQGDALQAIYFVCSGSMEVLK
DSMVLAILGKGDLIGANLSIKDQVIKTNADVKALTYCDLQCIILKGLFEVLGLYPEYAHK
FVEDIQHDLTYNLREGHESDVISRLSNKSTVSQAEPKGNGSINKRLPSIVEDEEEEEVEE
EETTSLSPIYTRGSSVSHSKKTGSNKTYLGLSLKQLASGTVPFHSPIRVSSANSPKTKQE
ADPPNHGRKKEKNLKVQLSSLGSAGTPELSPRIVDGIEDGNSNEETQTFDFGSEQIRPEP
RISPPLAESEIGAAFLFIKAEETKQQINKLNSEVTTLTQEVSQLGRDMRSIMQLLENILS
PQQPSQFCSLHPTPMCPSRESLQTRVSWSAHQPCLHLQAGGAHLYHGNVASGIWSVDPSL
VGSSPQRTEAHEQNPADSELHHSPNLDYSPSHCQVIQEGHLQFLRCISPHSDTTLTPLQS
ISATLSSSVCSSSETSLHLVLPSRSEEGSITHGPVSSFSLENLPGSWDREQMMSASSERL
ENFPVEVVTSTADVKDSKAINV
NT seq 3309 nt   +upstreamnt  +downstreamnt
atgccggttatgaaaggattactggcgccacagaacaccttcctggacactattgccacc
cgtttcgacggaacacatagcaacttcatcctggccaatgcccaagtggcaaagggtttc
cccatagtctactgttcagatggcttctgtgagctggccgggtttgcacgaactgaagtc
atgcagaagagctgcagctgcaagtttttgtttggggtggagaccaacgagcagctgatg
cttcagatagaaaagtccctggaggagaaagtagaattcaaaggagaaattatgttctac
aagaagaatggggctccattttggtgcctgctggatatcgttcctataaagaatgagaaa
ggagatgtagtccttttcctggcctcattcaaagacataacagacacgaaagtgaagatt
acatcagaagataaaaaagaagacagaaccaaaggaagatcaagagcagggagccacttt
gactcagcccggagacggagccgagccgtcctttatcacatctcaggacaccttcaaaga
agagaaaagaacaaattgaaaataaataataacgtgtttgtagataaaccagcgtttcca
gagtataaggtttctgatgcaaaaaagtccaagttcatcctgctgcatttcagcactttc
aaagctggctgggactggctcattttgctggcaacgttttatgttgctgtgacagtccct
tacaatgtgtgtttcattggcaatgaggacctgtccaccactcggagcacaacggtcagt
gacattgcagtggagatactgttcattatagatattattctaaatttccgaacaacttat
gtcagcaagtctggccaagttatctttgaagcgagatccatttgcattcactacgtcacc
acctggttcatcattgatctgattgctgccttgccctttgacctcctgtatgctttcaat
gtcacagtggtgtccctcgttcatctcctgaagactgttcggctgctgcgtcttttgcgc
ctcctccagaagctggaccgttattctcagcacagtaccatcgtcctcaccctgctcatg
tccatgtttgctctccttgcacactggatggcatgtatctggtatgtcattggaaaaatg
gagagggaggacaacagccttctcaagtgggaagtcggttggcttcatgagctggggaag
agactggaatctccatattatggcaacaacacgctggggggcccatccatccgaagtgcc
tatattgcggccctgtacttcactctcagcagcctcacaagcgttgggtttgggaatgtg
tctgctaacacagatgcagagaagatcttctccatctgcaccatgctgattggagccctg
atgcatgccttagtatttgggaacgtgactgccatcatacagagaatgtactctagatgg
agcctgtaccacactagaaccaaggacctaaaagacttcatccgtgtgcaccacctgccc
cagcaactcaagcagaggatgctcgagtactttcagacaacttggtcagtcaacaatggg
atagattcaaatgagcttttaaaagactttccagatgagctgcgctctgacatcacaatg
catctgaacaaggagatcttacagctgtccctgttcgaatgtgccagccggggctgcctc
aggtctctgtctctccatattaaaacctccttttgtgctccaggagagtatctgctgcgc
cagggggatgctttgcaggccatctacttcgtgtgctcaggctctatggaagttcttaaa
gacagcatggtgttggctattctagggaagggagatttaattggagcaaatttatcaatt
aaagaccaagtgatcaagaccaacgctgatgtgaaggcgctgacctactgtgatctacag
tgcatcatcctgaaaggtctctttgaggtgctgggcctttacccagagtatgcacacaaa
ttcgtagaagacatccagcacgacctcacatacaaccttcgagaaggtcatgagagtgat
gtaatatcaagattatcgaacaaatctacagtctcacaggcagagcccaaggggaatgga
agcatcaacaagagactcccatccattgtggaagatgaggaggaagaagaggttgaggaa
gaggagacgacctccctttctcctatctacacaaggggatcctctgtctcacatagcaaa
aagactggaagcaataagacctatctaggcttgagcttaaagcaactggcctcaggaacg
gtaccattccactcacctatcagagtctccagtgccaactcccctaaaaccaagcaggaa
gctgacccacctaaccatggtagaaagaaagagaagaacctgaaagtgcagctttccagc
ctgggtagtgctggaaccccagagcttagtccaaggattgttgatggaattgaagatggt
aacagcaatgaggaaactcagacttttgactttggctctgaacagatcaggccagagccc
aggatttcccctccccttgcagaatccgagatcggagctgcgtttctgttcatcaaggct
gaagaaaccaagcagcagattaacaagctcaacagtgaggtcacaacattaactcaggag
gtttcccagctagggagagatatgagaagcatcatgcaacttctggaaaacatcttgtca
cctcagcagccatcccagttttgttctctacatcccaccccaatgtgtccttccagagaa
agtttacagactagggtgagttggagtgctcaccagccttgcctacatttgcaggcaggt
ggagcacatctttaccatggtaatgtcgcctctggtatctggagtgttgatccatccttg
gtgggcagcagccctcaacgaactgaagctcacgagcaaaacccagcagacagtgaactt
catcattctccaaacctggattattctccatcccactgccaggttatccaagaaggccac
ttgcagttcctgaggtgcatctccccccattcagataccacactgacacctttgcagtcc
atctctgccactctctcatcttctgtgtgctcctcatcagaaacatccttgcacctggtt
ctcccaagtaggtcagaggagggcagcatcactcacggaccggtgagttctttcagtttg
gaaaacttaccaggctcttgggaccgagaacaaatgatgtcagcctcttcagaacgcttg
gagaactttccagtagaagttgtcacaagcacagcggatgtaaaggacagcaaagccata
aacgtataa

DBGET integrated database retrieval system