KEGG   Mus musculus (mouse): 211488
Entry
211488            CDS       T01002                                 

Gene name
Ado, Gm237
Definition
(RefSeq) 2-aminoethanethiol (cysteamine) dioxygenase
  KO
K10712  cysteamine dioxygenase [EC:1.13.11.19]
Organism
mmu  Mus musculus (mouse)
Pathway
mmu00430  Taurine and hypotaurine metabolism
mmu01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00430 Taurine and hypotaurine metabolism
    211488 (Ado)
Enzymes [BR:mmu01000]
 1. Oxidoreductases
  1.13  Acting on single donors with incorporation of molecular oxygen (oxygenases)
   1.13.11  With incorporation of two atoms of oxygen
    1.13.11.19  cysteamine dioxygenase
     211488 (Ado)
SSDB
Motif
Pfam: PCO_ADO
Other DBs
NCBI-GeneID: 211488
NCBI-ProteinID: NP_001005419
MGI: 2685083
Ensembl: ENSMUSG00000057134
UniProt: Q6PDY2
Position
10; 10 B5.1
AA seq 256 aa
MPRDNMASLIQRIARQACLTFRGSSTGSEGPAPGFPENLSLLKSLLTQVRAEDLNIAPRK
ALPQPLPRNLPPVTYMHIYETEGFSLGVFLLKSGTCIPLHDHPGMHGMLKVLYGTVRISC
MDKLDTGAGHRRPPPEQQFEPPLQPLEREAVRPGVLRSRAEYTEASGPCVLTPHRDNLHQ
IDAVDGPAAFLDILAPPYDPEDGRDCHYYRVVEPIRPKEASGSACDLPREVWLLETPQAD
DFWCEGEPYPGPKVLP
NT seq 771 nt   +upstreamnt  +downstreamnt
atgccccgcgacaacatggcctccctgatccagcgcatcgctcgccaggcgtgtctcacc
ttccgcggcagctcgacgggctccgaagggccggcgccgggcttcccggagaacctgagc
ctgctcaagagcctgctgacccaggtgcgcgccgaggacctcaacatcgcgccgcgcaag
gcgctgccgcagccgctgccccgcaacctcccgccggtcacctacatgcacatctacgag
acggagggcttcagcctgggcgtgttcctgctcaagagcggcacgtgcatcccgctgcac
gaccacccgggcatgcacggtatgctcaaggtgctgtacggcacggtccgcatcagctgc
atggacaagctggacacgggggccgggcatcggcggccgccgccagagcagcagttcgag
cccccgctgcagcccttggagcgggaggccgtgcgaccgggcgtgctgcgttcccgggcc
gagtacaccgaggccagtgggccctgcgtgctcactccacaccgggacaacctgcaccag
attgatgccgtggacgggccagctgccttcctggacatcctggccccaccctacgacccg
gaggacggccgggactgccactattaccgtgtagtggagcccatcagacccaaggaggct
tccggctctgcctgcgaccttccccgagaagtgtggctcctggagacaccacaggccgac
gacttctggtgcgagggagagccctatccaggccccaaggtcctaccttga

DBGET integrated database retrieval system