KEGG   Mus musculus (mouse): 211499Help
Entry
211499            CDS       T01002                                 

Gene name
Tmem87a, A930025J12Rik
Definition
(RefSeq) transmembrane protein 87A
Organism
mmu  Mus musculus (mouse)
SSDB OrthologParalogGFIT
Motif
Pfam: Lung_7-TM_R
Motif
Other DBs
NCBI-GeneID: 211499
NCBI-ProteinID: NP_001103967
MGI: 2441844
Ensembl: ENSMUSG00000033808
Vega: OTTMUSG00000015281
UniProt: Q8BXN9
Position
2; 2 E5
AA seq 558 aa AA seqDB search
MAVKMAVAAWLQVSPVIFLLLGAQPFPLSFLGAGPAPVFAADRSKWHIPMPSGKGYFNFG
KILFRNTTILLKFDGEPCDQSLNITWFLKSADCYNEIYNFKADEIESYLENLKGKKGLSG
RYQTSSRLFQNCSELYKAQSFSGDFTHRLPLLGEKQEAKENATNVTFTGDKIAMHEPLQT
WQDAPYIFIVHVGISSSKESPKENALSNLFTMTVEVKGPYEYLTLEDYPLMIFFMVMCIV
YVLFGVLWLAWSACYWRDLLRIQFWIGAVIFLGMFEKAVFYAEFQNIRYKGESVQNALVL
AELLSAVKRSLARTLVIIVSLGYGIVKPRLGVTLHKVVVAGALYLLFSGMEGVLRVTGAQ
TDLASLAFIPLAFLDTALCWWIFISLTQTMKLLKLRRNIVKLSLYRHFTNTLILAVAASI
VFIIWTTMKFRIVTCQSDWRELWVDDAIWRLLFSMILFVIMILWRPSANNQRFAFSPLSE
EDEEDEQKEPMLKESFEGMKMRSTKQEPNGTSKVNKAEDDLKWVEENVPSSVTDVALPAL
LDSDEERMITHFERSKME
NT seq 1677 nt NT seq  +upstreamnt  +downstreamnt
atggctgtgaagatggcggtggctgcgtggcttcaggtgtctcctgttatttttcttctt
ttaggggcgcagccgttcccattatcgtttcttggtgcaggtccggcacccgtgtttgct
gcagatagatcgaagtggcacattccgatgccgtcggggaaaggttattttaattttgga
aagattcttttcagaaatactaccatcttactgaaatttgatggagagccttgtgaccag
tctttaaatataacctggtttctgaaaagtgctgattgctacaatgaaatctacaatttc
aaggcagatgaaatagagtcatacttggaaaatctcaagggaaaaaaaggcttgtctggg
agataccaaacatcatcaagattatttcagaactgtagtgaactctataaagcacagagc
ttttctggggattttacacatcgacttcctcttttgggagaaaaacaggaggctaaggag
aatgcaacaaatgttacctttactggagacaaaattgcaatgcatgaaccattgcagact
tggcaagatgctccatacatttttatcgtgcatgttggcatctcgtcctcaaaggaatca
ccaaaagaaaatgcactaagtaacctttttaccatgactgttgaagtaaagggtccctat
gaataccttactcttgaagactacccactgatgatttttttcatggtgatgtgtattgtg
tacgtactatttggtgttctctggctggcatggtctgcttgctactggagagatctcctg
agaattcaattttggattggtgctgtcatctttcttggaatgtttgagaaagctgtgttt
tatgcagaatttcagaatatccgatacaaaggagaatctgtccagaatgccttggtcctt
gcagagctgctctcagcagtaaagcgctcactggctcgaaccctggtcatcatagtcagt
ctgggatacggcatagtcaagcctcgccttggagtcactcttcacaaggttgtggtggca
ggggcactttatcttttattctctggcatggaaggagtcctcagagttacaggggcccag
actgatcttgcttccttggcctttatacccttggctttcctagacactgccctgtgctgg
tggatattcattagcttaactcaaaccatgaagctattaaaacttcggaggaacattgta
aagctctctttgtaccgacatttcaccaatacgcttatcttggcagtggcagcgtctatt
gtgttcatcatctggacgaccatgaagttcagaatagtgacttgccagtcggactggcga
gagctgtgggtagatgatgccatttggagattgctgttttccatgatcctctttgtcatc
atgattctttggcggccatcagcaaataaccagaggtttgccttctcaccgttgtcagag
gaagatgaggaggatgagcagaaggagccgatgctgaaggaaagctttgaaggaatgaaa
atgagaagtaccaagcaggaaccaaatgggactagtaaagtaaacaaagcagaagatgat
ttgaaatgggtagaagaaaatgtcccttcttctgtgactgatgtagcacttccggccttg
ctggactcagacgaggaacgaatgatcacacactttgaaaggtcaaagatggagtaa

DBGET integrated database retrieval system