KEGG   Mus musculus (mouse): 211548
Entry
211548            CDS       T01002                                 

Symbol
Nomo1, D7Ertd156e, Nomo, pM5
Name
(RefSeq) nodal modulator 1
Organism
mmu  Mus musculus (mouse)
SSDB
Motif
Pfam: CarboxypepD_reg SdrD_B SpaA DUF2012 CarbopepD_reg_2 fn3_3
Other DBs
NCBI-GeneID: 211548
NCBI-ProteinID: NP_694697
MGI: 2385850
Ensembl: ENSMUSG00000030835
Vega: OTTMUSG00000043294
UniProt: Q6GQT9
Position
7 B3; 7 29.66 cM
AA seq 1214 aa
MRAGRCAAALLLLLLSGAGRAIGSEDIVVGCGGFVKSDVEINYSLIEIKLYTKHGTLKYQ
TDCAPNNGYFMIPLYDKGDFILKIEPPLGWSFEPTNVELRVDGVSDICTKGGDINFLFTG
FSVNGKVLSKGQPLGPAGVQVSLRSTGADSKIQSTVTQPGGKFAFFKVLPGDYEILATHP
TWALKEASTTVRVTNSNANAAGPLIVAGYNVSGSVRSDGEPMKGVKFLLFSSLVNKEDVL
GCNVSPVSGFQPPDESLVYLCYAVSKEDGSFSFYSLPSGGYTVVPFYRGERITFDVAPSR
LDFTVEHDSLRIEPVFHVMGFSVTGRVLNGPDGEGVPEAVVTLNNQIKVKTKADGSFRLE
NITTGTYTIHAQKEHLYFEMVTIKIAPNTPQLADLIATGFSICGQIAIVRSPDTIKQMSK
YRVVLSSQDKDKALLTVDSDAHGSFCFKAKPGAYKVQVVVPEAETRAGLMLKPQVFPLTV
TNRPVMDVAFVQFLASVSGKVSCLDTCGDLLVTLQSLSRQGEKRSLQLSGKVNSMTFTFD
KVLPGRYKISIMHEDWCWRNKSLEVEVLEDDVSAVEFRQTGYMLRCALSHAITLEFHQDG
NGPENVGIYNLSRGVNRFCLSKPGVYKVTPRSCHRFEQAFYTYDTSSPSILTLTAIRHHV
LGTIITDKMMDVTVTIKSSIDSEPALVLGPLKSAQELRREQQLAEIETRRQEREKNGKEE
GEEGRARPPGQEMVDELQGPFSYDFSYWARSGEKITVTPSSKELLFYPPSMEATVSGESC
PGKLIEIHGKAGLFLEGQIHPELEGVEIVISEKGASSPLITVFTDDKGAYSVGPLHSDLE
YTVNSQKEGYVLTAVEGTVGDFKAYALAGVSFEIKAEDDQPLPGVLLSLSGGVFRSNLLT
QDNGILTFSNLSPGQYYFKPMMKEFRFEPSSQMIEVQEGQNLRITITGFRTAYSCYGTVS
SLNGEPEQGVAVEAVGQKDCSIYGEDTVTDEEGKFRLRGLLPGCMYHVQLKAEGNDHIER
ALPHHRVIEVGNNDVDDVNIIVFRQINQFDLSGNVITSSEYLSTLWVKLYKSESLDNPIQ
TVSLGQSLFFHFPPLLRDGENYVVLLDTTLPRSQYDYVLPQVSFTAVGYHKHITLVFSPT
RKLPEQDIAQGSYIALPLTLLLLLAGYNHDKLIPLLLQLTSRLQGVRALGQAASDSSGPE
DMKRQTKKQKTRRT
NT seq 3645 nt   +upstreamnt  +downstreamnt
atgcgtgcgggccggtgtgccgcggcgctgctgctgctgctactgagcggcgcggggcgc
gcgatcggctccgaggacatcgtggtaggctgcgggggtttcgtgaagtcggacgtggag
atcaactactcgctcatcgagataaagttatacaccaagcatgggactttgaaatatcag
acggactgtgctcctaacaacggctactttatgatccccttgtatgataagggggatttc
atcctgaagatcgaacctcctctgggctggagttttgagccaaccaacgtggagctgcga
gtggatggtgtgagcgacatctgcacgaagggcggggacatcaacttcctgttcactggc
ttctctgtgaatggcaaggtcctcagcaaagggcagcccctgggcccagcaggagttcag
gtatccctgagaagcaccggtgctgactcgaagatccagtctacagtcacgcagcctggc
ggaaagtttgcgtttttcaaagttcttcctggagattatgaaatccttgcaactcacccg
acctgggcgctgaaggaggcaagtaccacggtgcgtgtgacgaactcgaatgctaacgca
gctggtcccctcatagtggctggctataatgtgtccggctctgtccgcagtgacggggag
cccatgaaaggggtgaagtttcttctcttttcttctttagtgaacaaagaggatgtcctg
ggctgcaatgtgtccccagtgtccgggttccagcccccagatgagagcctggtttatctg
tgctatgcggtctccaaagaagacggctcattttctttctattccttgccgagtgggggc
tacactgtggtgcccttctaccgaggagaaaggatcaccttcgacgtggcgccctcccgg
cttgacttcacggtggagcacgacagcctgagaatcgagcctgtattccacgtcatgggc
ttctctgtcaccgggagagtcttgaatggacctgacggagaaggcgtcccagaggctgtg
gtcaccctgaacaaccagattaaagtcaaaacgaaggctgacggctccttccgcctggag
aacataacgacagggacatacaccatccacgctcagaaggagcacctctacttcgagatg
gtcaccatcaaaattgcccccaacaccccacagctggctgacctcatcgctacagggttc
agcatctgtggtcagatcgccatcgtccgctcccccgacaccatcaagcagatgagtaaa
tacagagtggtcctgtcctcccaagacaaggacaaggctttgctcactgtggacagcgat
gcccatggatcattttgctttaaagcaaaaccaggggcctacaaagtccaggtggtggta
cccgaggctgagaccagagcagggctgatgttgaagccgcaggtattccccctcactgtg
accaacaggcctgtgatggatgtggccttcgtgcagtttctggcatcggtttccgggaaa
gtctcctgtctggatacctgcggtgacctgttggtgaccctgcagtccctgagccgccag
ggtgagaaacgcagcctccagctctcaggcaaagtcaactccatgactttcacctttgac
aaagttctgcctgggagatacaaaataagcatcatgcatgaggactggtgctggaggaac
aagagtctggaagtggaagtgctggaggacgacgtgtctgcggtggagttcaggcagacc
ggttacatgctgcgctgcgcactctcacacgccatcactctggaatttcatcaggacgga
aatggccctgaaaatgtggggatttacaatctctccaggggagtgaaccgcttctgcctg
tccaagcctggtgtgtacaaagtgactccccgctcctgccaccggtttgagcaagccttt
tacacctatgacacgtcttcacccagtatcctgacgctgacagccattcgtcaccatgtt
cttggaacaatcattactgacaaaatgatggacgtcacagtgactatcaagtcttccatc
gacagcgagccagccttggtcttgggacctctgaagtctgcacaggagctgcggagggaa
cagcagctggcagagatcgagactcgcaggcaggagagggagaagaatggcaaagaagag
ggcgaagaaggcagggcccggcctcctgggcaggagatggtggatgagttacagggcccc
ttctcctacgacttctcctactgggcccggtctggagagaaaatcactgttacaccctcg
tccaaagagctcctcttttatcccccatccatggaagccactgtcagtggagaaagctgt
ccagggaagttaattgagatccatgggaaggcgggcttgttcctggaaggccagattcac
ccagagctggagggagtcgagattgtcatcagcgagaagggagcaagttcacccttgatc
actgtcttcaccgatgacaaaggtgcctacagtgttggtcccctacacagtgacctggag
tatactgtgaactcacagaaggagggctacgtgctgactgccgtggaaggaaccgtggga
gacttcaaggcttatgccttggccggcgtgagcttcgagattaaagctgaagacgaccag
ccgctccctggggtcctcttatccctcagtggtggcgtgtttcgttccaacctcctgacc
caagacaacggcattctgactttctcaaacctgagccctggacagtactactttaaaccc
atgatgaaggagttccgctttgagccatcctcacagatgatagaagtgcaggaggggcag
aacctgaggatcaccatcactggctttcgaactgcctacagctgctacggcactgtgtcg
tctttaaatggagagccagagcagggtgtcgcggtggaggctgtggggcagaaagactgc
agcatctatggagaagacacggtgacagacgaggaggggaagttccggttacgtgggctg
ctgccagggtgcatgtaccacgtgcagctgaaggcagaaggcaatgaccacatcgagcgg
gcgctgccccaccaccgggtgattgaggttgggaacaatgacgtggatgacgtaaacatc
atagttttccggcagatcaaccagtttgacctgagtggaaacgtaatcacttcctccgag
tatctgtctaccttgtgggtgaagctgtacaaaagcgagagtctcgacaaccccatccag
acggtgtctctgggccagtcgctcttcttccacttcccaccgctgctccgagatggcgag
aactatgtggtgctgctggacaccacgctccccagatcccagtacgactacgtcctgccg
caagtctctttcactgcagtgggctaccacaagcacatcactctggttttcagtcccacg
aggaagctccctgaacaagacattgcgcaggggtcctatattgccctgcctctgacgctg
ctgctcctgttggcgggctacaaccatgacaagctcattcctttgctgctgcagctgacg
agtcgtcttcagggagtcagagcccttggccaggcggcctctgacagcagcggcccagaa
gacatgaagagacaaaccaagaaacagaagaccagacgcacgtga

DBGET integrated database retrieval system