KEGG   Mus musculus (mouse): 211550
Entry
211550            CDS       T01002                                 

Symbol
Tifa, T2bp
Name
(RefSeq) TRAF-interacting protein with forkhead-associated domain
  KO
K23826  TRAF-interacting protein with FHA domain-containing protein A
Organism
mmu  Mus musculus (mouse)
SSDB
Motif
Pfam: FHA
Other DBs
NCBI-GeneID: 211550
NCBI-ProteinID: NP_660115
MGI: 2182965
Ensembl: ENSMUSG00000046688
Vega: OTTMUSG00000036830
UniProt: Q793I8 I3PQW8
Structure
Position
3:127582524..127592043
AA seq 184 aa
MSTFEDADTEETVTCLQMTIYHPGQQSGIFKSIRFCSKEKFPSIEVVKFGRNSNMCQYTF
QDKQVSRIQFVLQPFKQFNSSVLSFEIKNMSKKTSLMVDNQELGYLNKMDLPYKCMLRFG
EYQFLLQKEDGESVESFETQFIMSSRPLLQENNWPTQNPIPEDGMYSSYFTHRSSPSEMD
ENEL
NT seq 555 nt   +upstreamnt  +downstreamnt
atgtccacctttgaagacgctgatacagaggagacggtcacttgtctccagatgaccatt
taccatcctggccaacaaagtgggatatttaaatcaataaggttttgcagcaaagagaag
tttccttccattgaagtggtgaaatttggacgcaattccaacatgtgccagtatacgttt
caggacaaacaggtgtcccgaattcagtttgttttacagccgtttaaacagttcaacagc
tccgttctctcgtttgaaataaaaaacatgagcaagaaaaccagtttgatggtagacaac
caggagctcggctacctcaataaaatggacctgccttacaagtgtatgctcaggttcgga
gagtatcagttcctgttgcagaaggaagacggagagtcggtggaatcttttgagactcaa
tttatcatgtcttcaagacctctcttgcaagaaaacaactggccaacacagaatcccata
ccagaggatgggatgtattcttcatacttcacccacagaagttctccttcagaaatggat
gaaaacgaactgtga

DBGET integrated database retrieval system