KEGG   Mus musculus (mouse): 211578
Entry
211578            CDS       T01002                                 

Gene name
Mrgprd, Gm499, Mgrd, Mrg, MrgD, TGR7
Definition
(RefSeq) MAS-related GPR, member D
  KO
K08392  Mas-related G protein-coupled receptor member D
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04614  Renin-angiotensin system
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09150 Organismal Systems
  09152 Endocrine system
   04614 Renin-angiotensin system
    211578 (Mrgprd)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:mmu04030]
    211578 (Mrgprd)
G protein-coupled receptors [BR:mmu04030]
 Rhodopsin family
  Others
   Mas proto-oncogene and Mas-related (MRGs)
    211578 (Mrgprd)
SSDB
Motif
Pfam: 7tm_1 7TM_GPCR_Srx
Other DBs
NCBI-GeneID: 211578
NCBI-ProteinID: NP_987075
MGI: 3033142
Ensembl: ENSMUSG00000051207
Vega: OTTMUSG00000059893
UniProt: Q91ZB8 Q5UCB4
Position
7; 7 F5
AA seq 321 aa
MNSTLDSSPAPGLTISPTMDLVTWIYFSVTFLAMATCVGGMAGNSLVIWLLSCNGMQRSP
FCVYVLNLAVADFLFLFCMASMLSLETGPLLIVNISAKIYEGMRRIKYFAYTAGLSLLTA
ISTQRCLSVLFPIWYKCHRPRHLSSVVSGALWALAFLMNFLASFFCVQFWHPNKHQCFKV
DIVFNSLILGIFMPVMILTSTILFIRVRKNSLMQRRRPRRLYVVILTSILVFLTCSLPLG
INWFLLYWVDVKRDVRLLYSCVSRFSSSLSSSANPVIYFLVGSQKSHRLQESLGAVLGRA
LRDEPEPEGRETPSTCTNDGV
NT seq 966 nt   +upstreamnt  +downstreamnt
atgaactccactcttgacagcagcccagctccaggtctgaccatcagtcccaccatggac
cttgtgacctggatctacttttcagtgacattcctcgccatggccacgtgtgtggggggg
atggcaggcaactcattggtgatttggctcctgagctgcaatggcatgcagaggtctccc
ttctgtgtctatgtgctcaacctggcggtggctgacttcctcttcttattctgcatggcc
tccatgctcagcctggaaacagggcccctgctcatagtcaacatttctgccaaaatctat
gaagggatgaggagaatcaagtactttgcctatacagcaggcctgagcctgctgacagcc
atcagcacccagcgctgcctctccgtgcttttccccatctggtataagtgccaccggccc
cggcacctgtcatcagtggtatctggtgcactctgggcactggccttcctgatgaacttc
ctggcttctttcttctgcgtccaattctggcatcccaacaaacaccagtgcttcaaggtg
gacattgttttcaacagtcttatcctggggatcttcatgccggtcatgatcctgaccagc
accatcctcttcatccgggtgcggaagaacagcctgatgcagagacggcggccccggcgg
ctgtacgtggtcatcctgacttccatccttgtcttcctcacctgttctctgcccttgggc
atcaactggttcttactctactgggtggatgtgaaacgggatgtgaggctactttatagc
tgcgtatcacgcttctcttcgtctttgagcagcagtgccaacccggtcatttacttcctc
gtgggcagccagaagagccaccggctgcaggagtccctgggtgctgtgctggggcgggca
ctgcgggatgagcctgagccagagggcagagagacgccatccacgtgtactaatgatggg
gtctga

DBGET integrated database retrieval system