KEGG   Mus musculus (mouse): 211586Help
Entry
211586            CDS       T01002                                 

Gene name
Tfdp2, 1110029I05Rik, A330080J22Rik, DP-3, DP3
Definition
(RefSeq) transcription factor Dp 2
  KO
K09392  transcription factor Dp-2
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04110  Cell cycle
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    211586 (Tfdp2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:mmu03000]
    211586 (Tfdp2)
Transcription factors [BR:mmu03000]
 Eukaryotic type
  Helix-turn-helix
   Fork head/winged helix cell cycle-controlling factors, DP
    211586 (Tfdp2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DP E2F_TDP
Motif
Other DBs
NCBI-GeneID: 211586
NCBI-ProteinID: NP_001171635
MGI: 107167
Ensembl: ENSMUSG00000032411
Vega: OTTMUSG00000047569
UniProt: Q8BHD2 Q8C8M7
Position
9; 9 E3.3
AA seq 385 aa AA seqDB search
MIISTPQRIANSGSVLIGNPYTPAPAMVTQTHIAEAAGWVPSDRKRAREFIDSDFSESKR
SKKGDKNGKGLRHFSMKVCEKVQRKGTTSYNEVADELVSEFTNSNNHLAADSAYDQKNIR
RRVYDALNVLMAMNIISKEKKEIKWIGLPTNSAQECQNLEIEKQRRIERIKQKRAQLQEL
LLQQIAFKNLVQRNRQNEQQNQGPPAVNSTIQLPFIIINTSRKTVIDCSISSDKFEYLFN
FDNTFEIHDDIEVLKRMGMSFGLESGKCSLEDLKIAKSLVPKALEGYITDISTGPSWLNQ
GLLLNSTQSVSNLDPTTGATVPQSSVNQGLCLDAEVALATGQLPASNSHQSSSAASHFSE
SRGETPCSFNDEDEEDEEEDPSSPE
NT seq 1158 nt NT seq  +upstreamnt  +downstreamnt
atgattataagcacaccgcagagaattgccaattcaggaagtgttctgattgggaatcca
tatacccctgcacccgcaatggtcactcagactcacatagctgaggctgctggctgggtt
cccagtgatagaaaacgagctagagaatttatagactctgatttttcagaaagtaaacga
agcaaaaaaggagataaaaatgggaaaggcttgagacatttttcaatgaaggtgtgtgag
aaagttcagcggaaaggcacaacgtcatacaatgaggtagctgatgagctggtatctgag
tttaccaactcaaataaccatctggcagctgattcggcttatgatcagaagaacattaga
cgaagagtttatgatgctttaaatgtactaatggcgatgaacataatttcaaaggaaaaa
aaagaaatcaagtggattggcctgcctaccaattctgctcaggaatgccagaacctggaa
atcgagaagcagaggcggatagaacggataaagcagaagcgagcccagctacaagaactt
ctccttcagcaaattgcttttaaaaacctggtacagagaaatcgacaaaatgaacaacaa
aaccagggccctccagctgtgaattccaccattcagctgccatttataatcattaataca
agcaggaaaacagtcatagactgcagcatctccagtgacaaatttgaatacctttttaat
tttgataacacctttgagatccacgacgacatagaggtactgaagcggatgggaatgtcc
tttggtctggagtcaggcaaatgctctctggaggatctgaaaatcgcaaaatccctggtt
ccaaaagctttagaaggctatattacagatatctccacaggaccttcttggttaaatcag
ggactacttttgaactctacccaatcagtttcaaatttagacccgaccaccggtgccact
gtaccccaatcaagtgtaaaccaagggttgtgcttggatgctgaagtggccttagcaact
gggcagctccctgcctcaaacagtcaccagtccagcagtgcagcctctcacttctcggag
tcccgcggcgagaccccctgttcattcaacgatgaagatgaggaagatgaagaggaggat
ccctcctccccagaataa

DBGET integrated database retrieval system