KEGG   Mus musculus (mouse): 211914Help
Entry
211914            CDS       T01002                                 

Gene name
Asap2, 6530401G17Rik, Ddef2, Gm1523, Gm592, PAG3, PAP
Definition
(RefSeq) ArfGAP with SH3 domain, ankyrin repeat and PH domain 2
  KO
K12488  Arf-GAP with SH3 domain, ANK repeat and PH domain-containing protein
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04144  Endocytosis
mmu04666  Fc gamma R-mediated phagocytosis
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    211914 (Asap2)
 09150 Organismal Systems
  09151 Immune system
   04666 Fc gamma R-mediated phagocytosis
    211914 (Asap2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:mmu04131]
    211914 (Asap2)
Membrane trafficking [BR:mmu04131]
 Endosome - Golgi transport
  Arf GTPases and associated proteins
   Arf GTPase associated proteins
    211914 (Asap2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: ArfGap BAR_3 Ank_2 PH SH3_9 SH3_1 Ank Ank_5 BAR Ank_4 SH3_2 Ank_3 PH_9 PH_13
Motif
Other DBs
NCBI-GeneID: 211914
NCBI-ProteinID: NP_001091637
MGI: 2685438
Ensembl: ENSMUSG00000052632
Vega: OTTMUSG00000037685
UniProt: Q7SIG6
Structure
PDB: 

Position
12; 12 A1.2-A1.3
AA seq 958 aa AA seqDB search
MPDQISVSEFVAETHEDYKAPTASSFTTRTAQCRNTVAAIEEALDVDRMVLYKMKKSVKA
INISGLAHVENEEQYTQALEKFGGNCVCRDDPDLGSAFLKFSVFTKELTALFKNLIQNMN
NIISFPLDSLLKGDLKGVKGDLKKPFDKAWKDYETKITKIEKEKKEHAKLHGMIRTEISG
AEIAEEMEKERRFFQLQMCEYLLKVNEIKVKKGVDLLQNLIKYFHAQCNFFQDGLKAVES
LKPSIETLSTDLHTIKQAQDEERRQLIQLRDILKSALQVEQKESRRDSQLRQSTAYSLHQ
PQGNKEHGTERNGNLYKKSDGIRKVWQKRKCSVKNGFLTISHGTANRPPAKLNLLTCQVK
TNPEEKKCFDLISHDRTYHFQAEDEQECQIWMSVLQNSKEEALNNAFKGDDNTGENNIVQ
ELTKEIISEVQRMTGNDVCCDCGAPDPTWLSTNLGILTCIECSGIHRELGVHYSRMQSLT
LDVLGTSELLLAKNIGNAGFNEIMECCLPSEDPVKPNPGSDMIARKDYITAKYMERRYAR
KKHADTAAKLHSLCEAVKTRDIFGLLQAYADGVDLTEKIPLANGHEPDETALHLAVRSVD
RTSLHIVDFLVQNSGNLDKQTGKGSTALHYCCLTDNAECLKLLLRGKASIEIANESGETP
LDIAKRLKHEHCEELLTQALSGRFNSHVHVEYEWRLLHEDLDESDDDVDEKLQPSPNRRE
DRPVSFYQLGSSQFQSNAVSLARDTANLTKDKQRGFGPSILQNETYGAILSGSPPSSQSI
PPSTTSAPPLPPRNVGKDPLTTTPPPPVAKTSGTLEAMNQPSKSSQPGTSQSKPPPLPPQ
PPSRLPQKKPASGTDKPTPLTNKGQPRGPEASGPLSNAMALQPPAPMPRKSQATKSKPKR
VKALYNCVADNPDELTFSEGDVIIVDGEEDQEWWIGHIDGEPSRKGAFPVSFVHFIAD
NT seq 2877 nt NT seq  +upstreamnt  +downstreamnt
atgccggaccagatctccgtgtcggaattcgtggccgagacccatgaggactacaaggcg
cccacggcctctagcttcaccacgcgcacggcccagtgccggaacaccgtggcggccatc
gaggaggctttggacgtggaccggatggttctctacaaaatgaagaaatctgtgaaggca
atcaatatctctgggctggcacacgtggagaacgaggaacagtacacccaggctctggag
aagttcggtggcaactgtgtgtgcagagatgatccagacttaggaagcgcgtttctgaag
ttctctgtgttcaccaaggagttgacggcactcttcaaaaacctgattcagaacatgaac
aacatcatctcgttccctttggacagtttgctgaaaggagatctgaaaggagtaaaaggg
gatctgaaaaagccctttgataaagcttggaaggactatgaaacaaaaataaccaaaata
gaaaaggagaaaaaggagcatgccaagctccacgggatgattcgtactgaaataagcggg
gctgagattgcagaggagatggagaaggaaagacggttcttccagctgcagatgtgtgag
tacctgctgaaggtcaatgaaatcaaggtgaaaaagggagtggatttgcttcagaatctg
atcaagtactttcacgcccagtgcaattttttccaggatggattgaaagcagtagaaagc
ctcaagccttccatcgagacgctctccacggacctccacaccatcaaacaggcccaggat
gaggaacggcgacagctgatacaacttcgagatattttgaagtcagcattgcaggtggaa
cagaaagagtctaggagagactcacaacttcgccaaagtacagcctacagcttacatcaa
cctcagggaaacaaggagcatggaacagagaggaacgggaacctctacaagaagagcgat
gggatccggaaagtgtggcagaagaggaagtgttccgttaaaaatggcttcctcaccatc
tcccacggcactgccaaccggccacctgccaagctcaacctgctaacctgccaggtgaag
accaatcctgaggagaagaagtgtttcgacctcatatcacatgacaggacgtaccacttc
caagcggaagacgaacaagaatgtcagatatggatgtctgtactgcagaacagcaaggaa
gaagctctgaacaacgcctttaagggtgatgacaacactggagaaaataacatcgtccaa
gagctgaccaaggagatcatctcggaggtgcagaggatgacgggcaatgacgtgtgctgc
gactgtggggcaccagatccgacgtggctctctaccaacctgggcatcctgacttgcatc
gagtgctctgggatccaccgggagctgggggttcattactccaggatgcagtccctgaca
ttagatgtattgggaacgtctgagcttctgcttgccaagaatatcgggaatgcaggcttt
aatgaaattatggagtgttgcctaccgtctgaggacccagtcaagcccaacccaggcagt
gacatgattgcaaggaaggactacatcacagccaagtacatggagaggagatatgcacgg
aaaaagcatgccgacaccgcggcgaagctccacagcctttgcgaggccgtcaagaccaga
gacatttttgggttactccaagcttatgctgatggtgtggacctgacagagaaaatccca
ctggccaatgggcatgagccagatgagacagccctccatcttgcagtcagatctgtggac
cggacttcccttcacattgtagacttcctggtccagaacagtgggaacctggataaacag
acaggcaagggcagcacagccctgcactactgctgcctgacagacaatgctgagtgcctc
aagctcctcctgcggggaaaagcctccattgagatagccaatgagtcaggagagaccccg
ttggacattgctaagcggctcaagcacgaacactgtgaggaactgctcactcaggccttg
tcggggcggtttaactcccatgttcacgtcgagtatgaatggcggctgctgcacgaggac
ctggatgagagcgacgacgatgtggacgagaagctacagcctagtcccaaccgacgggag
gaccggcctgttagcttctaccagctggggtccagccagtttcagtccaatgctgtgtct
ttggccagagatactgcaaacctcaccaaggacaagcagaggggctttgggcccagcatc
ttgcagaatgagacctatggagccatcctgagtggcagcccgccctcctcccagtcaata
ccccccagcaccaccagcgcacccccgctcccacctcggaatgttggcaaagatcccctg
accaccacaccaccccctcctgtggctaagacatcaggaactctagaagccatgaaccag
ccgagcaagtcctcccaacctgggacctcacagagcaagcccccgcccctgccacctcag
ccacccagccgcctgcctcagaagaaaccagcttccgggactgacaagccaaccccgctg
accaacaaaggacagccgagaggacctgaagcttcgggtcctctgtccaacgccatggcc
ctgcagcccccagcacccatgcctaggaagtcacaggcgaccaagtcaaagcccaagcga
gtgaaagcactctacaactgcgtggctgacaacccagacgagctgactttctctgagggc
gacgtgatcattgtggatggggaagaggatcaggagtggtggatcggccacatcgatgga
gagcccagccgcaaaggagcgtttcccgtatcgtttgtgcactttattgctgactaa

DBGET integrated database retrieval system