KEGG   Mus musculus (house mouse): 211948
Entry
211948            CDS       T01002                                 
Symbol
Pde12, 2'-PDE, 2-PDE, E430028B21Rik
Name
(RefSeq) phosphodiesterase 12
  KO
K19612  2',5'-phosphodiesterase [EC:3.1.13.4 3.1.4.-]
Organism
mmu  Mus musculus (house mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:mmu03019]
    211948 (Pde12)
   03029 Mitochondrial biogenesis [BR:mmu03029]
    211948 (Pde12)
Enzymes [BR:mmu01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.4  Phosphoric-diester hydrolases
    3.1.4.-
     211948 (Pde12)
   3.1.13  Exoribonucleases producing 5'-phosphomonoesters
    3.1.13.4  poly(A)-specific ribonuclease
     211948 (Pde12)
Messenger RNA biogenesis [BR:mmu03019]
 Eukaryotic type
  mRNA degradation factors
   3'-5' decay
    Other 3'-5' decay factors
     211948 (Pde12)
Mitochondrial biogenesis [BR:mmu03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Other mitochondrial DNA transcription and translation factors
    211948 (Pde12)
SSDB
Motif
Pfam: Exo_endo_phos DUF4739
Other DBs
NCBI-GeneID: 211948
NCBI-ProteinID: NP_848783
MGI: 2443226
Ensembl: ENSMUSG00000043702
UniProt: Q3TIU4
Position
14:complement(26385272..26391001)
AA seq 608 aa
MWRLPGRSALRGVRSVVERRSRAEAGTHEAVRAMERAVVRCVPSEPKLSLSFALADGSHK
NMQRDQSEPLGRALSRIATNALKGHAKVAAAKKSRKNRAHSSGGAACEATGPEPVATCEP
VVKLYYREEAVAEDVLNVDAWQDGAVLQIGDVKYKVERNPPTFTELQLPRYIMAGFPVCP
KLGVEFGDPASSVFRWYKEVKPGAAEPGDSGPASSSHSSQPSAWIETGVDERVYTPCNAD
IGLRLRLHCTPGNGQRFGPSRELESLCPVEAGPGTCTFDHRHLYTKKVTEDSFIRTVSYN
ILADTYAQTEFSRTVLYPYCAPYALELDYRQNLIQKELTGYNADLICLQEVDRAVFSDSL
VPALEAFGLEGVFRIKQHEGLATFYRKSKFRLLSQHDISFQEALKSDPLHKELLEKLALN
PLAQEKVLQRSSVLQISVLQSTTDSSKKICVANTHLYWHPKGGYIRLIQMEVALVHIRHV
SRDLYPGIPVIFCGDFNSTPSTGMYHFVISGSIAEDHEDWASNGEEERCSMPLSHCFKLK
SACGEPAYTNYVGGFHGCLDYIFIDLNTLEVEQVIPLPSHEEVTTHQALPSVSHPSDHIA
LVCDLKWK
NT seq 1827 nt   +upstreamnt  +downstreamnt
atgtggaggctcccgggccgcagcgcgcttcgtggggtccggtcggtggtggagcggcgc
agccgggccgaggcagggactcacgaggcggtgcgcgccatggagcgcgcggtggtgcgc
tgtgtgccctcggagcccaagctcagcctgtctttcgcgttggccgacggcagccacaaa
aacatgcagagggaccagagcgagcctctgggccgggccctcagccggatcgctaccaac
gccctcaagggacacgcaaaggtagcggccgccaagaagagcaggaagaaccgagcccac
tcgagcggtggcgcggcctgtgaggctacagggcctgagccggttgcgacctgcgagccg
gtggtgaagctgtactaccgggaggaggcggtggccgaggatgtgctcaatgtggacgcc
tggcaggacggagcggtgctgcagatcggcgacgtcaagtacaaggtggagcgcaacccg
cccaccttcacggagctgcagttgccgcgctacatcatggctggcttccctgtgtgcccc
aaactcggcgtggaatttggggatcccgccagctccgtgttccgctggtacaaggaagtc
aaacccggggcggcagaacctggggacagcggccccgcgtcctcgtctcactcttcgcag
ccttcagcttggatcgagaccggtgtggacgagcgcgtctacaccccgtgcaatgcagac
atcgggctccggctccggcttcactgtacaccgggcaatgggcagcgcttcgggccaagc
cgggagctagaaagcctgtgcccggtggaggccgggcctggcacctgcacttttgaccat
cgacatctgtacaccaagaaggtgacggaggactctttcatccgcactgtctcctacaac
atcctggcagacacgtacgcccagactgagttctctcggacggtcttgtacccgtactgt
gccccctacgccctggagcttgactaccgccagaatctcatacagaaggagctcacaggc
tacaacgcagacctcatctgtttgcaggaggtggaccgcgcggtgttctccgacagcttg
gtaccggccctggaggccttcgggctggagggcgtgttccgaatcaagcagcacgaaggc
ctggccactttctaccggaagtccaagttcaggctccttagtcaacatgacatctctttt
caagaagccctcaagtcggacccactgcacaaagaattactagagaagctggctttgaac
ccattagcacaggagaaggtcctccagaggtcatctgtccttcagatttcagttcttcag
tctacaacagactcttccaaaaagatatgtgttgctaatacccatctctactggcaccca
aaaggtggatacattcgtctcattcaaatggaagtagccttggttcatattagacatgtc
tcacgtgatctctatcctggcataccagttatattttgtggagactttaatagtacacca
tcaacaggcatgtatcattttgtcatcagtggcagcattgcagaggatcatgaagactgg
gcttccaatggggaagaggagagatgcagcatgcctctctcacactgtttcaaactgaag
agtgcttgtggtgaacctgcctacacaaattatgtcggtggctttcacggatgtctagat
tacattttcattgacttaaatactttagaggttgaacaggtgattccattacctagtcat
gaagaagttaccacccaccaggccttacctagtgtttctcatccttctgatcacatagca
cttgtatgtgacttaaaatggaaatag

DBGET integrated database retrieval system