KEGG   Mus musculus (house mouse): 212070
Entry
212070            CDS       T01002                                 
Symbol
Clrn3, AI649392, Tmem12
Name
(RefSeq) clarin 3
  KO
K23841  clarin
Organism
mmu  Mus musculus (house mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   03037 Cilium and associated proteins [BR:mmu03037]
    212070 (Clrn3)
Cilium and associated proteins [BR:mmu03037]
 Primary cilia and associated proteins
  USH complex and associated proteins
   212070 (Clrn3)
SSDB
Motif
Pfam: Claudin_2 DuoxA DUF6773 DUF5684 CitMHS
Other DBs
NCBI-GeneID: 212070
NCBI-ProteinID: NP_848784
MGI: 2142022
Ensembl: ENSMUSG00000050866
UniProt: Q8BHH8
Position
7:complement(135113185..135130383)
AA seq 226 aa
MPTTQKTLMFLSGFLTSLGSVVVICSILATQAWITSRIFFTDAISNGTIVITYGLFRGTS
AQELNEGLQDLDKNFEVLGILDNSSQKSLHLVVILLLILSLAASVLSSVFTFYNSISNPY
QTFLGPMGVYTWNGLSASFVFLAMVLFVGNAESNHLSDKLSQKLYPDTTNKRTTHTYGYS
FWLTLHVIFLNIVTAVIIIFYQKARYRQKQEQRKPVEYAPRDGILF
NT seq 681 nt   +upstreamnt  +downstreamnt
atgccaaccacacagaaaacgttgatgttcctgtctggctttctcacaagcctgggctca
gttgttgtcatctgctccattcttgcgactcaggcatggatcaccagcaggattttcttt
acagatgctatctccaacggtaccattgttattacctatgggctcttccgtggtacgagt
gctcaagagttgaatgaaggccttcaagatctggacaaaaactttgaagttttagggata
ttggacaattcttcccagaagtctttgcacctggtggtcatcctcctcctgatcctgagt
ctggcagcttccgtgctgagctcagtgttcaccttctacaacagcatcagcaacccttac
cagacgttcctgggacctatgggtgtctatacctggaatggactcagcgcatcctttgtg
tttctggccatggttctgttcgtggggaatgccgagtccaaccatctctcagacaagctc
tcccagaagctttatccagataccacaaacaagagaacaacccacacttacggatactcg
ttttggctcaccctgcatgtcatctttctcaatattgtcactgcggtcatcatcattttc
tatcagaaggcccgataccggcagaagcaggagcagaggaagccggtggaatatgctcca
agggatggcattttattctga

DBGET integrated database retrieval system