KEGG   Mus musculus (house mouse): 212111
Entry
212111            CDS       T01002                                 
Symbol
Inpp5a
Name
(RefSeq) inositol polyphosphate-5-phosphatase A
  KO
K01106  inositol polyphosphate 5-phosphatase INPP5A [EC:3.1.3.56]
Organism
mmu  Mus musculus (house mouse)
Pathway
mmu00562  Inositol phosphate metabolism
mmu01100  Metabolic pathways
mmu04070  Phosphatidylinositol signaling system
mmu04910  Insulin signaling pathway
Module
mmu_M00131  Inositol phosphate metabolism, Ins(1,3,4,5)P4 => Ins(1,3,4)P3 => myo-inositol
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    212111 (Inpp5a)
 09130 Environmental Information Processing
  09132 Signal transduction
   04070 Phosphatidylinositol signaling system
    212111 (Inpp5a)
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    212111 (Inpp5a)
Enzymes [BR:mmu01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.56  inositol-polyphosphate 5-phosphatase
     212111 (Inpp5a)
SSDB
Motif
Pfam: Glyco_hydro_cc OLF Exo_endo_phos
Other DBs
NCBI-GeneID: 212111
NCBI-ProteinID: NP_001120835
MGI: 2686961
Ensembl: ENSMUSG00000025477
UniProt: Q7TNC9
Position
7:138969025..139159568
AA seq 412 aa
MAGKAAAPGTAVLLVTANVGSLFDDPENLQKNWLREFYQVLHTHKPHFMALHCQEFGGKN
YEASMSHVDKFVKELLSSDAMKEYNRARVYLDENYKSQEHFTALGSFYFLHESLKNIYQF
DFKAKKYKKVTGKEIYSDTLESTPMLEKEKFPQDYFPECKWSRKGFIRTRWCIADCAFDL
VNIHLFHDASNLVAWETSPSVYSGVRHKALGYVLDRIIDQRFEKVSYFVFGDFNFRLDSK
SVVETLCTKATMQTVRAADTNEVVKLIFRESDNDRKVVLQLEKKLFDYFNQDVFRDNNGT
ALLEFDKELSVFKDRLYELDISFPPSYPYSEDSSQGEQYMNTRCPAWCDRILMSLSAKEL
VLKSESEEKVATYDHIGPNVCMGDHKPVFLAFRIAPGAGKPHAHVHKCCVVQ
NT seq 1239 nt   +upstreamnt  +downstreamnt
atggcggggaaggcggccgcccccggcaccgcggtcctgctggtcacggccaacgtgggc
tcgctcttcgacgacccagaaaacctgcagaagaactggcttcgggaattttaccaggtc
ctgcacacacacaagcctcacttcatggccttgcactgccaagaatttggagggaaaaac
tacgaggcctccatgtcccatgtggacaaatttgtcaaagaactactatccagtgacgca
atgaaagaatacaacagggcgcgtgtctacctggatgaaaactacaagtcacaggaacac
ttcacggcactaggaagcttttattttcttcacgaatccttaaaaaacatctaccagttt
gactttaaagctaagaagtataaaaaagtcactggcaaggagatctattcggacactttg
gagagcacacccatgctggagaaggagaagttcccacaggactactttcctgagtgcaaa
tggtcaagaaaaggcttcatcaggacgcggtggtgcattgctgactgtgccttcgacttg
gtgaacattcatctttttcatgatgcatccaacttagtggcctgggagacaagcccctca
gtgtactccggtgtcaggcacaaggctctgggctatgtgctggacagaatcatcgaccag
cgatttgagaaagtttcctactttgtcttcggtgatttcaacttccgcctggattccaag
tctgtcgtagagacactctgcacaaaggccacaatgcagacagtccgcgctgctgatacc
aatgaagttgtaaagttgatatttcgggagtcagacaatgaccggaaggtcgtgctccag
ttggaaaagaagctcttcgactacttcaaccaggatgtcttccgggacaacaacggcact
gcgctcttggaatttgacaaggagttgtctgtctttaaggacagactgtatgaactggac
atctcattcccccccagctacccgtacagtgaggactccagccagggagaacagtacatg
aacacgagatgccctgcttggtgtgatcgcatcctcatgtccctgtctgccaaggagctg
gttcttaagtcagagagcgaggagaaggttgccacctacgaccacatcgggcctaatgtc
tgcatgggagaccacaagccggtgttcctggccttccgaatcgcacctggggcaggtaaa
cctcacgcccatgtacacaagtgttgtgtcgtgcagtga

DBGET integrated database retrieval system