KEGG   Mus musculus (mouse): 212114
Entry
212114            CDS       T01002                                 

Gene name
Nhlrc3, 4833441N19, 8030451K01Rik, mKIAA4083
Definition
(RefSeq) NHL repeat containing 3
Organism
mmu  Mus musculus (mouse)
SSDB
Motif
Pfam: NHL SGL Lactonase
Other DBs
NCBI-GeneID: 212114
NCBI-ProteinID: NP_766089
MGI: 2444520
Ensembl: ENSMUSG00000042997
Vega: OTTMUSG00000022219
UniProt: Q8CCH2
Position
3; 3 C
AA seq 347 aa
MARAWVCLAGAAFFLSCLVLHSRFCGSLVSRTFSFHVSWRMEDPLFRLDLGWPKNSEYFT
GATFCVAVDSLNGLVYVAQRGDNIPKVLVFSEDGYFLRAWNYTVDTPHGMFVSGTPFEQS
VWITDVGSGPYGHTVKKYNSLGDLVQVLGTPGKKGTGLNPLQFDNPAELYVDDTGEMYIV
DGDGGLNNRLVKLSQDFMILWLRGENGTGPAKFNIPHSVTLDAVGRVWVADRGNKRLQVF
DKDTGEWLGAWDNCFTEEGPSAVRFTPDGKYLIVAQLNLSRLSVLLAPPSGSIGDCSVVS
TIQLADQVLPHLLEVDRKTGAVYVAEIGAKQIQKYIPWHSRTPAFGA
NT seq 1044 nt   +upstreamnt  +downstreamnt
atggcgagagcctgggtctgcctggcgggcgccgccttcttcctttcctgtctggttttg
cattcgcgcttctgtggctcgctggtttcaaggacattttcttttcacgtttcctggaga
atggaggaccctcttttccggctggatttgggttggcccaagaattcggaatacttcact
ggtgcaacattttgtgttgcagttgattccctcaacgggttagtttacgtagcccaaaga
ggggataacatccccaaggtattagtgttctcagaggatggctatttcctacgagcctgg
aattatacagttgacacaccccatggtatgtttgtctccggcacaccatttgaacagtcc
gtctggatcacggacgtaggaagcggaccctacggccatactgttaaaaaatataattcc
ctgggtgatcttgttcaagtcttgggaaccccaggcaagaagggcactggcttgaacccg
ctgcagtttgacaaccctgcagaattatatgtagatgacacaggggagatgtacattgtg
gatggagatgggggactgaataacagactggtcaaactatcccaagatttcatgatcctc
tggctgcgtggagagaatgggacaggacctgccaagttcaacatacctcacagcgttaca
cttgacgcagttggtcgggtgtgggttgcggaccgaggaaataagaggctccaagtattt
gataaggacactggagagtggttaggagcatgggacaactgtttcacagaggaggggcct
tctgctgtgaggttcaccccagatgggaagtacttgattgtggcccagctgaacctcagt
aggctgtcagtgttgcttgccccaccctccggaagcatcggagactgctctgtggtcagc
actatccagctggcagatcaggttctgccacatcttttggaagtcgacagaaagactggc
gcagtgtatgtagcagaaattggggcaaaacaaatacaaaaatacatcccgtggcacagc
cgcacccctgccttcggcgcttag

DBGET integrated database retrieval system