KEGG   Mus musculus (mouse): 212168
Entry
212168            CDS       T01002                                 

Gene name
Zswim4, D330002I24, E130119J17Rik
Definition
(RefSeq) zinc finger SWIM-type containing 4
Organism
mmu  Mus musculus (mouse)
Motif
Pfam: SWIM
Other DBs
NCBI-GeneID: 212168
NCBI-ProteinID: NP_766091
MGI: 2443726
Ensembl: ENSMUSG00000035671
Vega: OTTMUSG00000061278
UniProt: Q8C7B8
Position
8; 8 C2
AA seq 1101 aa
MEPPAAKRSRGCPAGDEPGTGARRSRPEPLLDLSAKRVAESWAFEQVEERFSRVPEPVQK
RIVFWSFPRSEREICMYSSLGYQPPEGEQDTRVPFTRGLHLLQSGAVDRVLQVGFHLSGN
IREVGGPGEPEHLYHVSISFDRCKITSVSCGCDNRDLFYCAHVVALSLYRIRHARQVELR
LPISETLSQMNRDQLQKFVQYLISAHHTEVLPTAQRLADEILLLGSEINLVHGAPDPTAG
AGTEDANCWHLDEEQIQEQVKQLLSNGGHYGASQQLRSMFSKVREMLRARDSNGARMLIL
MTEQFLQDPRLALWRQQGAGMTDKCRQLWDELGALWVCVILSPHCKPDERSGWLQLLGTW
DKLDVCPLEEGNYSLDIPSLQPALTSRTGSEDEEEVTAASPRRTVFSRALQAGELHWNDS
HLQRILASDSCGPTLTGSMGSDKPTFDPQGHPIWLGEPFPTACARVDTLRAHGYPHKALR
LACAIINTLRLQRRHQLESYKQQKKELLQKGATGVTSTEGWVGHPLDPIGCLCRALLEAC
RLEEEPHSLFPDSAPEKRKLAYQHVLVPGSPGESYLALALEVALLGLGQQRALPEGLYAQ
DKVVRNEEQLLALLEEVELDERLVQVLRKQAGLLLEGGPFSGFGEVIFRESVPMHTCARY
LFTALLPHDPDLAFRLALRAMRLPVLETTFPAGESHPNPLDSIMSNRFPRWFILGHLETR
QCELASTMLTAAKGDTKWLHAVLGSVQQNIHSPALLFKLAQDACKTATPASAPPDTVLLG
IALELGLQVMRMTLNTMTWRRREMVRWLVSCATEIGPPALMSIMKNWYSLFTPVEAVTIV
AVTGTTHATLLRLQLDTAGREELWACARTLALQCAMKDPQNCALPALTLCEKNHAAFEAA
YQIVLDAAAGGLGHAHLFTVARYMEHRGLPLRAYKLATLALAQLSIAFNQDSHPAVNDVL
WACSLSHSLGRHELSAIVPLIIRSIHCAPMLSDILRRWTLSAPGLGPLGARRATKPLGTD
RAPLCQLLDAAVAAYITTSHSRLTHISPRHYGDFIEFLGKARETFLLAPDGHLQFAQFLE
NLKQTYKGKKKLMLLVRERFG
NT seq 3306 nt   +upstreamnt  +downstreamnt
atggagcccccggcggccaagcgcagccggggctgccccgcgggggacgagcccgggacc
ggggcccgtcgcagtcgccccgagccgttgttggaccttagcgccaagcgggtggccgag
agctgggccttcgagcaggtggaggaaaggttctcccgggtgccggaaccggttcagaag
cgcattgtgttctggtcttttccacgaagtgagcgggagatctgtatgtactcatcactg
ggctaccagcccccagaaggtgagcaggacacccgggtaccattcacccgtgggctgcac
ctgctacagagtggggctgtggatcgagtgctacaagtagggttccacctgagtgggaat
attcgagaagttgggggcccaggagagccagagcatctctaccacgtctccatcagcttt
gaccgctgcaagatcacatctgtgagctgtggctgcgacaatcgggacctcttctactgt
gcccacgtggtggcgctgtcattgtaccgcatccgtcatgctcgccaggtggagctgcgg
ctgcccatctctgagactctgtcacaaatgaaccgggatcagcttcagaagtttgtgcag
tatctcatcagtgcacaccacactgaggtgctgcctaccgcccaacgtcttgctgacgag
atcctcctgctgggctctgagatcaacctggttcatggtgccccagatcccacagcgggt
gcaggcacagaagatgccaactgttggcatctggatgaggagcagatccaagagcaggtg
aaacagctgctgtccaatggtggccactatggggccagccagcagctgcgctccatgttc
agcaaggtgcgggagatgcttcgagcacgggactccaatggggcacgcatgctaatcctc
atgactgagcagttcctgcaggaccctcgcctggccctgtggcggcagcaaggtgctggc
atgacagacaagtgccggcagctgtgggatgagctgggggctttgtgggtctgtgtcatt
ttgagcccacactgcaaaccagatgagcggtcgggatggctgcagctacttggcacatgg
gacaagctagatgtgtgcccactggaagaaggcaactattccttggacatccccagccta
cagcctgctctaacctccaggacaggctcagaggatgaagaagaggtgacagccgccagc
ccccgcaggacagttttcagccgagcactgcaggctggagagttgcactggaatgacagc
cacctacagaggatcctggccagtgattcctgtggccccaccctcactggcagtatggga
agtgacaagccaacctttgaccctcagggccaccccatctggctgggcgaacctttccct
actgcctgtgcacgggtggatactttgcgggcccatggttatccccacaaggctctgcgg
ctggcgtgtgccataatcaacaccctgcgcctgcagaggcgacaccagcttgagagctac
aagcagcagaaaaaagaactgctccagaaaggtgctactggtgtcacaagcactgaaggt
tgggtgggccatcccctggatcccattggctgcctctgcagggcactgctggaggcctgt
cgcctggaggaggagcctcactctcttttcccagactcagccccagagaagcgaaagctg
gcctaccagcacgtgctggtgcccgggagccctggagagtcctacttggcactggcactg
gaagtggcactcctggggctagggcagcagcgggccctgccggagggactgtatgcccag
gacaaagtggtgcgcaatgaagaacagctactggccctgctggaggaggtggagctggac
gagcggctggtgcaagtgctgcgaaagcaggctgggctgctgctggaaggaggccctttc
agcggctttggagaagtgattttccgggagagcgtacccatgcacacctgtgcccgatac
ttgttcactgcgctgctgccccacgacccagatctggccttccgcctggcgctccgagcc
atgaggctgcctgtgctggagacaacattccccgctggagaatctcaccccaacccactg
gactccatcatgagtaaccgcttcccccggtggttcatccttggccacctggagacccgc
cagtgtgagctggcctccaccatgctgacggctgccaaaggagataccaagtggctgcat
gcggttctgggctccgtccagcaaaatatccactccccagccctgctcttcaagttggca
caggatgcctgcaagacagccactccagccagcgcaccgccagacaccgtgctgctgggc
atcgcgctggagctcggcctgcaggtgatgcggatgacactgaacaccatgacttggcgg
cgcagggagatggttcgctggctggttagctgcgccacggagattggcccaccagcgctg
atgagcatcatgaagaactggtactccttgttcaccccagtggaggcggtcaccatagtg
gcagtgacaggcaccacgcatgccactttgctgcgactgcagctagatacagctgggcga
gaggagctctgggcttgtgcccgcaccttggcactgcagtgcgccatgaaggatccccag
aactgcgccttgccagccctgaccctgtgtgagaagaaccacgcggcctttgaggctgcc
taccagattgtgctggacgctgcagccggtggcctcggccacgcccacctcttcacggtt
gcacggtatatggagcatcgaggcctgcctctgcgggcctacaagctggccacgctagcc
ttggcacaactcagcattgccttcaaccaagacagccaccctgcagtcaacgatgtgctg
tgggcctgctccctcagccactcgctggggcggcacgaattgtcggccattgtccctctc
atcatccgaagcatccactgtgcacccatgctctcagacatcctgcgacgctggacactc
tcagcacccgggctgggcccactgggggcccgcagggctaccaaaccactagggactgac
agggcaccactttgtcagcttctggatgccgcagtagccgcgtacataaccaccagccac
tctcgcctcacccacattagcccacgccactatggtgacttcattgagttcctgggcaaa
gctcgagagaccttccttctggcaccagacgggcacctccagttcgcacagttcttagaa
aacctgaaacagacgtacaagggaaagaagaagttgatgctgttggttcgggaacggttt
ggctga

DBGET integrated database retrieval system