KEGG   Mus musculus (mouse): 212190
Entry
212190            CDS       T01002                                 

Symbol
Ubxn10, 5730509E04Rik, A830047D02, Ubxd3
Name
(RefSeq) UBX domain protein 10
  KO
K24352  UBX domain-containing protein 10
Organism
mmu  Mus musculus (mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:mmu03036]
    212190 (Ubxn10)
Chromosome and associated proteins [BR:mmu03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Other cilium assembly proteins
    212190 (Ubxn10)
SSDB
Motif
Pfam: UBX
Other DBs
NCBI-GeneID: 212190
NCBI-ProteinID: NP_001272857
MGI: 2443123
Ensembl: ENSMUSG00000043621
Vega: OTTMUSG00000010000
UniProt: Q8BG34
Position
4:complement(138437148..138465749)
AA seq 277 aa
MAIEAPVNFAPPERSTVVSTAGDSSTWQPSSLRMHVIRPKSAKGRKRPNLHRPQGMGDGS
PSALSSSPPPRSSGSPSNQKPGVCATVSTSQGAPDEMPELLLQQAPTRTASSLNRYPVLP
SINRRSLEVGAVDTVASKTSSLQLSSVQALYQEDSSQEDSRTQVCALEKKFIIRTKRQSS
SRASNIEEPSDEEPRLLLAVRSPSGQRFVRYFRPSDDLQTVLEVAEQKNKATYQHCSIET
MEVPRRRFSDLTKSLQECGILHKSVLGISQEEGEAWP
NT seq 834 nt   +upstreamnt  +downstreamnt
atggccatagaagcccctgtgaactttgcaccacctgaacgcagcactgtggtcagcacc
gcaggcgacagctccacctggcagcccagctcactcaggatgcacgttatcaggcccaag
tctgccaagggccggaagcggccgaatttgcacagaccacaaggcatgggggacggctcc
cccagtgcactatcctcttcacctccaccacggtcctccgggtctcccagcaaccagaaa
ccaggagtctgtgcaacggtctcaacatctcagggagctcctgacgagatgccggagttg
ctgctgcagcaggcaccgacacggaccgcctcatctctcaacaggtacccggtcctccca
tccatcaacaggaggagcttagaggtgggagccgtggacactgtggccagcaagaccagt
tccctgcagctgagcagcgtccaggccctttaccaagaggattcaagccaggaagactcc
agaacgcaggtctgtgccttagagaagaagttcatcatccgaaccaaaagacagagctcc
tccagggcctccaacatcgaggagccgtcggacgaagagccaaggctgctgctggctgtc
cggtcaccctcaggccaaaggttcgtgcgctatttcaggcccagtgacgacctccagacc
gtcctcgaggtggccgagcagaaaaacaaagccacctaccaacactgcagcattgagacg
atggaagtgcccaggagacggttctccgacctcaccaagtccctccaggaatgcggcatc
cttcataaatccgtgttgggcatctcgcaggaggagggggaggcgtggccctga

DBGET integrated database retrieval system