KEGG   Mus musculus (mouse): 212281Help
Entry
212281            CDS       T01002                                 

Gene name
Zfp729a, A530054K11Rik, Rslcan3
Definition
(RefSeq) zinc finger protein 729a
  KO
K09228  KRAB domain-containing zinc finger protein
Organism
mmu  Mus musculus (mouse)
Pathway
mmu05168  Herpes simplex virus 1 infection
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09160 Human Diseases
  09172 Infectious disease: viral
   05168 Herpes simplex virus 1 infection
    212281 (Zfp729a)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:mmu03000]
    212281 (Zfp729a)
Transcription factors [BR:mmu03000]
 Eukaryotic type
  Zinc finger
   Other Cys2His2 zinc factors
    212281 (Zfp729a)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: zf-H2C2_2 zf-C2H2 zf-C2H2_4 KRAB BolA Zn-ribbon_8 C1_1 Zf_RING zf-C2H2_6 Desulfoferrod_N zf-C2H2_11 XPA_N FYVE zf-C2HC_2 zf-trcl C1_4 Zn_ribbon_SprT zf-C2H2_jaz
Motif
Other DBs
NCBI-GeneID: 212281
NCBI-ProteinID: NP_898969
MGI: 3036250
Ensembl: ENSMUSG00000021510
Vega: OTTMUSG00000042801
UniProt: Q4QQP3
Position
13; 13 B3
AA seq 973 aa AA seqDB search
MEFGAGTSAFFQEMLSFRDVAIDFSAEEWECLEPAQWNLYRDVMLENYSNLVFLGLASCK
PHLITCLEQIQEPSDVKRGAATSMLRGEKCYTCKECGKVFEWTKVFQNHEMLYIGMNPNK
CEECARSFHSPSLSSEENRIHTGEKPYKCEVCGKAFCIPLLLSKHKRVHTGENLYKCEVC
GKAFQHPSRLSRHKKIHSEEKPYKCEVCGKAFHFPSLLLVHKRVHTGEKPYKCEICDKAF
HYPSILSKHKRIHTGEKPYKCEECGKAFHISSFLSKHKIIHRGEKPYKCEVCGKAFHYPS
RLSNHKKIHSGEKPFKCEVCGKAFRILSLLSKHKIIHTEENPYKCEVCGKAFDYPSRLST
HAKMHTGEKPYKCEVCQKAFRSLSSLSKHKRIHTEDNYYNNELCGKAFIYPSRLSKHKRI
CAGEKPYKCEVCGKAFHVSSLLSKHRTIHTGEKLYKCEVCGKAFYYPSRLSNHKKIHTGE
KPFQCEVCGKAFCFPSSLSKHKRIHTGEKPYKCKECGKAFRSLSSLSKHKRIHTGEKPYK
CEECGKAFHYPSLLSKHKIIHTEEKPYKCDVCGQAFHVPSKLSHHKIIHTGEKPYKCEVC
GKAFCIPLLLSKHKRVHTGENPYNSQVCSKAFVYPSKLSKHKKVRTKEKPYKCEVCGKAF
RFPSLLLIHKGMHTGEKPYKCEDCGKAFHYPSLLSKHKRIHTGEKPYQCEVCGKDFHVSS
SLSKHRIIHTGEKPYKCEICGKTFRFSSSLSKHKRNHTGKKPYKCEECGKAFHFPSILAK
HKISHTGEKPYNCDLCGKAFHYASLLSKHKMIHTGEKPHKCDICGKAFHYPSKLSNHKKI
HTGEKPYKCEVCGNVFCFASSLSKHKRIHTGENPYKCEVCGKAFYYPSLLSKHKIIHTGE
KPYKCDLCGKAFHYPSLLSKHKVIHTGKKPYKCEVCGKAFHYPSRLSKHKKIHGAGDMAQ
QLRDLAAISIVLS
NT seq 2922 nt NT seq  +upstreamnt  +downstreamnt
atggagttcggtgcagggaccagcgccttctttcaggaaatgctgtcattcagggatgtg
gccattgatttctctgcagaggagtgggaatgcctggagcctgctcagtggaatctgtac
agggacgtgatgctcgagaactacagcaaccttgtgttcctgggtcttgcttcgtgtaag
ccacatctgatcacatgtctggagcaaatacaagagccttcagatgtgaaaagaggagca
gctacctctatgctccggggagaaaaatgttatacgtgcaaagagtgtggcaaagttttt
gagtggaccaaagtgttccaaaatcatgagatgctttatataggaatgaatcccaacaag
tgtgaagaatgtgccaggtccttccatagtccatcattaagttctgaagagaacagaatt
catacaggagaaaaaccttacaaatgtgaagtttgtggcaaggccttctgcattccatta
ttactttctaaacacaagagagttcatacaggagagaatctctacaagtgtgaagtgtgt
ggcaaggccttccaacatccatcaagactttccagacataagaagattcattcagaagag
aaaccatacaagtgtgaagtatgtggaaaggccttccactttccatcattacttttggta
cacaagagagttcatacaggagagaaaccatacaaatgtgaaatatgtgacaaagccttc
cattatccatcaatactctctaaacacaagcgaattcatacaggagagaaaccatacaaa
tgtgaagaatgtggcaaggccttccacatttcatcatttctttctaaacacaaaataatt
catagaggagaaaaaccctacaagtgtgaggtatgtggcaaggccttccattatccatca
agactttccaaccataagaaaatccattcaggagagaaaccattcaagtgtgaagtatgt
gggaaggccttccgcattttatcactcctttctaagcacaagataattcatacagaagag
aatccttacaagtgtgaagtatgtggcaaggctttcgattatccctcaagactttctacc
catgcaaaaatgcatacaggagagaaaccatacaagtgtgaagtatgtcaaaaggctttt
cgttctctgtcatcactttctaaacacaagagaattcatacagaagataattattataac
aatgaattatgtggcaaggccttcatttatccttcaagactctctaaacataagagaatt
tgtgcaggagagaagccctacaagtgtgaagtatgtggcaaggccttccatgtttcatca
ctgctttctaaacacaggacaattcatacaggagaaaaactctataagtgtgaagtatgt
gggaaggccttttattatccatcaagactttccaaccataagaaaattcatacaggagag
aaaccattccagtgtgaagtatgtgggaaggccttctgttttccttcatcactatctaaa
cacaagagaattcacacaggagagaaaccatacaaatgtaaagagtgtggaaaggccttc
cgctctctgtcctcactttctaaacacaagagaattcacacaggagagaaaccctacaag
tgtgaagaatgtggcaaggccttccattatccatcattactttctaaacacaagataatt
catacagaagaaaaaccttacaagtgtgacgtatgtggccaggcattccatgttccatca
aaactttctcatcacaagataattcatacaggagaaaaaccctacaagtgtgaagtgtgt
ggcaaggccttctgcattccattattactttctaaacacaagagagttcatacaggagag
aatccctataacagtcaagtatgtagcaaggccttcgtttatccttcaaaactttctaag
cataagaaagttcgtacaaaagagaaaccatacaagtgtgaagtatgtggaaaggccttc
cgctttccatcattactactaatacacaagggaatgcatactggagaaaaaccctacaag
tgtgaagattgtggcaaggccttccattatccatcactactttctaaacacaagcgaatt
catacaggagaaaagccataccagtgtgaagtgtgtggcaaggacttccatgtttcatca
tcactatctaaacacaggataattcatacaggagagaagccatacaagtgtgaaatatgt
gggaagaccttccgcttttcatcatcactatctaaacacaagagaaatcatacaggaaag
aaaccctacaagtgtgaagaatgtggcaaggccttccattttccatcaatacttgcaaaa
cacaagataagtcacactggagagaaaccctacaattgtgacttatgtggcaaggccttc
cattatgcatcattactttctaaacataagatgattcatacaggagaaaaaccccacaag
tgtgatatatgtggcaaggccttccattatccttcaaaactttccaaccataagaaaatt
catacaggagagaaaccctacaagtgtgaagtatgtgggaatgtcttctgttttgcatct
tcactttctaaacacaagagaattcacacaggagagaatccgtacaagtgtgaagtgtgt
ggcaaagccttctattatccatcattactttctaaacacaagatcattcatacaggagag
aaaccctacaagtgtgacttatgtggcaaggccttccattatccatcattactttctaaa
cacaaggtaattcatacaggaaaaaaaccctacaagtgtgaagtgtgtggcaaagccttc
cattatccctcacgactttccaagcataagaaaattcatggggctggagacatggctcag
cagttaagagatctggctgcaatttcaattgtgctgtcctga

DBGET integrated database retrieval system