KEGG   Mus musculus (mouse): 212307
Entry
212307            CDS       T01002                                 

Symbol
Mapre2, AI314113, C820009F03Rik, D18Abb1e, EB1, EB2, RP1
Name
(RefSeq) microtubule-associated protein, RP/EB family, member 2
  KO
K10436  microtubule-associated protein, RP/EB family
Organism
mmu  Mus musculus (mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:mmu03036]
    212307 (Mapre2)
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:mmu04812]
    212307 (Mapre2)
Chromosome and associated proteins [BR:mmu03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Microtubules and associated factors
    Microtubule-associated proteins
     212307 (Mapre2)
Cytoskeleton proteins [BR:mmu04812]
 Eukaryotic cytoskeleton proteins
  Microtubules
   Tubulin-binding proteins
    EB / APC
     212307 (Mapre2)
SSDB
Motif
Pfam: EB1 CH CAMSAP_CH ING Sad1_UNC
Other DBs
NCBI-GeneID: 212307
NCBI-ProteinID: NP_694698
MGI: 106271
Ensembl: ENSMUSG00000024277
Vega: OTTMUSG00000028208
UniProt: Q8R001
Position
18 A2; 18 12.08 cM
AA seq 326 aa
MPGPTQTLSPNGENNNDIIQDNGTIIPFRKHTVRGERSYSWGMAVNVYSTSITQETMSRH
DIIAWVNDIVSLNYTKVEQLCSGAAYCQFMDMLFPGCISLKKVKFQAKLEHEYIHNFKLL
QASFKRMNVDKVIPVEKLVKGRFQDNLDFIQWFKKFYDANYDGKEYDPVEARQGQDAIPP
PDPGEQIFNLPKKSHHANSPTAGAAKSSPASKPGSTPSRPSSAKRASSSGSASRSDKDLE
TQVIQLNEQVHSLKLALEGVEKERDFYFGKLREIELLCQEHGQENDDLVQRLMEVLYASD
EQEGQTEEPEAEEQAHDQQPQQQEEY
NT seq 981 nt   +upstreamnt  +downstreamnt
atgcccgggccgacccaaacgttgtccccaaatggcgagaacaacaacgacatcatccag
gataacgggactatcattcctttccggaagcacacagtgcgcggggagcggtcctacagt
tggggaatggcggtcaatgtgtattctacctcgataacccaggagactatgagcaggcat
gacatcattgcatgggtcaatgacatcgtgtctctaaactacacaaaagtggaacagctc
tgttcaggagcagcctattgccagttcatggacatgctcttcccgggctgtattagtttg
aagaaagtaaaattccaagcaaagttggagcatgagtatattcacaactttaaacttctg
caagcatcctttaaacggatgaatgttgataaggtaatcccagtggagaagctggtgaaa
gggcgtttccaagacaacctggattttattcagtggtttaagaagttctacgatgctaac
tatgacgggaaggagtacgatcctgttgaggcccgacaagggcaagatgcaattcctccc
cctgaccctggtgaacagatcttcaacctgcccaagaagtcgcaccatgcaaactccccc
acagcaggcgcggctaagtcaagtcctgcatctaagccaggatccacaccttctcgcccc
tcgtctgccaaaagggcttcatccagtggctctgcatccagatctgacaaagatttagaa
acgcaggtcatacagctcaacgagcaggtacattcattgaaactcgccctagaaggtgtg
gagaaggagagggatttctacttcgggaagttgagagagattgagctgctgtgccaagaa
catgggcaggagaacgatgacctcgtgcagcgactaatggaagtgctctacgcttccgat
gaacaggagggccaaacggaagagccagaagcagaggagcaagcccatgaccagcagccc
cagcagcaggaggagtactga

DBGET integrated database retrieval system