KEGG   Mus musculus (mouse): 212391
Entry
212391            CDS       T01002                                 

Gene name
Lcor, 3110023F06Rik, A630025C20Rik, Gm340, Mlr2, mKIAA1795
Definition
(RefSeq) ligand dependent nuclear receptor corepressor
Organism
mmu  Mus musculus (mouse)
SSDB
Motif
Pfam: HTH_psq
Other DBs
NCBI-GeneID: 212391
NCBI-ProteinID: NP_742166
MGI: 2443930
Ensembl: ENSMUSG00000025019
UniProt: Q6ZPI3 A4FTY7
Position
19; 19 C3
AA seq 433 aa
MQRMIQQFAAEYTSKTSSTQDPSQPNSTKNQSLPKASPVTTSPTAATTQNPVLSKLLMAD
QDSPLDLTVRKSQSEPSEQDGVLDLSTKKSPCASSTSLSHSPGCSSTQGNGRPGRPSQYR
PDGLRSGDGVPPRSLQDGTREGFGHSTSLKVPLARSLQISEELLSRNQLSTAASLGPSGL
QNHGQHLILSREASWAKPHYEFSLSRMKFRGNGALSNISDLPFLAENSAFPKMAHQTKQD
GKRDMSHSSPVDLKIPQVRGMDLSWESRTGDQYSYSSLVMGSQTESALSKKLRAILPKQN
RKSMLDAGPDSWGSDAEQSTSGQPYPTSDQEGDPGSKQPRKKRGRYRQYNSEILEEAISV
VMSGKMSVSKAQSIYGIPHSTLEYKVKERLGTLKNPPKKKMKLMRSEGPDVSVKIELDPQ
GEAAQSANESKTE
NT seq 1302 nt   +upstreamnt  +downstreamnt
atgcagcgaatgatccaacaatttgctgctgaatatacctcaaaaactagctctactcag
gaccccagccagcccaatagcacaaagaaccaaagcctgccgaaagcatctccagtcacc
acctctcccacggctgcaactactcagaaccccgtgctcagcaaactgctcatggctgac
caagactcacctctggaccttactgtcagaaagtctcagtcagaacctagtgaacaagac
ggtgtacttgacttatctactaagaaaagtccatgtgctagcagcacttccctgagccat
tctccaggctgctccagtactcaagggaacgggcgacctgggagacccagccagtaccgc
ccagatggacttcggagtggtgatggggtacctccaagaagcttacaggatggaaccagg
gaaggctttggacactccacatcactcaaagttccactggctcgatctctgcagattagt
gaagaactactgagcagaaaccaattgtccacggctgccagccttggtccgtctggatta
cagaatcacggacagcacttaatcttatccagggaagcctcttgggcaaaacctcactat
gaattcagcctcagccgaatgaagttcaggggaaatggtgcactcagcaacattagtgac
cttcctttcctcgcagaaaactctgccttcccaaaaatggcacatcaaacaaaacaagat
ggaaaaagggacatgagccattcatctcctgtagatttaaagataccacaagttcgagga
atggatctttcttgggagtctcgcactggtgatcagtacagctatagctctttggtaatg
ggttcacaaacggagagcgcgcttagtaaaaaattaagggctattcttccaaaacaaaat
agaaaaagcatgttagatgctggacctgattcttggggctcagatgctgagcagtctacc
tctggacagccatatcccacatcggatcaagaaggagaccctggctccaagcagccgcgg
aagaaaagagggcgttacagacagtacaacagtgagatactggaggaagccatctcggtg
gttatgagtggaaaaatgagtgtttccaaagctcagagtatttatgggattccccacagt
acactggagtacaaagtaaaggagaggctgggcactttgaaaaaccctccaaagaaaaag
atgaaattaatgaggtcggaggggccagatgtttctgtaaagattgaattagatccccag
ggagaggcagcacaaagtgcaaatgaatcaaaaactgagtag

DBGET integrated database retrieval system