KEGG   Mus musculus (mouse): 212442
Entry
212442            CDS       T01002                                 

Gene name
Lactb2, Cgi-8, Cgi-83, E430032H21Rik
Definition
(RefSeq) lactamase, beta 2
  KO
K16639  endoribonuclease LACTB2 [EC:3.1.27.-]
Organism
mmu  Mus musculus (mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:mmu03029]
    212442 (Lactb2)
Enzymes [BR:mmu01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.27  Endoribonucleases producing 3'-phosphomonoesters
    3.1.27.-  
     212442 (Lactb2)
Mitochondrial biogenesis [BR:mmu03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Other mitochondrial DNA transcription and translation factors
    212442 (Lactb2)
Motif
Pfam: Lactamase_B BLACT_WH Lactamase_B_2 Lactamase_B_3
Other DBs
NCBI-GeneID: 212442
NCBI-ProteinID: NP_663356
MGI: 2442551
Ensembl: ENSMUSG00000025937
Vega: OTTMUSG00000021599
UniProt: Q99KR3
Position
1; 1 A3
AA seq 288 aa
MAAALQRIEQLSSRVVRVLGCNPGPMTLQGTNTYLVGTGSRRILIDTGEPSVPEYISCLK
QALVEFDTAIQEILVTHWHSDHSGGIVDICKNINNDTTYCIKKLRRNPQREEIIGNGEQQ
FIYIENGDVVKTEGATLRVLYTPGHTDDHMALLLEEENAIFSGDCILGEGTTIFEDLYDY
MNSLNNLLKIKANIIYPGHGPVIHNAEAKILEYISHRNNREEQIISLFRDNFEKSFTVTE
LRTMIYKDVPENLHKMAEHNLLLHLRKLEKDGKIFYTTTPVKKWKAVL
NT seq 867 nt   +upstreamnt  +downstreamnt
atggctgccgctctgcagcgcatcgagcagctgtccagtcgggtggtgcgcgtgttgggc
tgcaacccgggtcccatgaccctgcaaggcaccaacacgtacctggtggggaccggcagc
aggagaatcctcattgacactggtgagccatcagttccagaatatatcagctgtttaaag
caagccttggttgagtttgacacagcaatccaggaaatcctggtgacacactggcattct
gatcattctggaggcattgtagacatttgtaaaaacatcaataatgacaccacctactgc
attaaaaaacttcgacggaatccccagagagaagaaattataggaaatggagaacagcaa
tttatttatatagaaaacggagacgtggttaagaccgagggagccactctcagagttttg
tacactcctggccacactgatgatcacatggctttactcctggaggaggagaatgccatc
ttttctggggactgcatcctaggagaagggacgacaatatttgaagacctctatgattat
atgaactccctaaacaacttactaaaaatcaaagctaacattatatatccaggacatggc
ccagtcatccataatgctgaagctaaaattctggaatatatttctcatagaaataaccga
gaagaacagattatttcattattccgtgataactttgagaaatcatttaccgtaacggaa
cttaggacaatgatttacaaggatgttccagagaatttacataagatggcagagcataat
ctcttgcttcatttgagaaaactagagaaagatgggaagatattctacacaacaactcct
gtcaagaaatggaaagccgtcctttag

DBGET integrated database retrieval system