KEGG   Mus musculus (mouse): 212503
Entry
212503            CDS       T01002                                 

Gene name
Paox, 2410012F02Rik, AI118225, Pao
Definition
(RefSeq) polyamine oxidase (exo-N4-amino)
  KO
K00308  N1-acetylpolyamine oxidase [EC:1.5.3.13]
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04146  Peroxisome
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04146 Peroxisome
    212503 (Paox)
Enzymes [BR:mmu01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.3  With oxygen as acceptor
    1.5.3.13  N1-acetylpolyamine oxidase
     212503 (Paox)
SSDB
Motif
Pfam: Amino_oxidase NAD_binding_8 Lycopene_cycl FAD_binding_2 Pyr_redox_2 DAO NAD_binding_9 Thi4
Other DBs
NCBI-GeneID: 212503
NCBI-ProteinID: NP_722478
MGI: 1916983
Ensembl: ENSMUSG00000025464
Vega: OTTMUSG00000027287
UniProt: Q8C0L6
Structure
PDB: 
5MBX 5LFO 5LGB 5LAE

Position
7; 7 F4
AA seq 504 aa
MAFPGPRVLVVGSGIAGLGAAQKLCSHRAAPHLRVLEATASAGGRIRSERCFGGVVELGA
HWIHGPSQDNPVFQLAAEFGLLGEKELSEENQLVDTGGHVALPSMIWSSSGTSVSLELMT
EMARLFYGLIERTREFLNESETPMASVGEFLKKEISQQVASWTEDDEDTRKRKLAILNTF
FNIECCVSGTHSMDLVALAPFGEYTVLPGLDCILAGGYQGLTDRILASLPKDTVAFDKPV
KTIHWNGSFQEAAFPGETFPVLVECEDGARLPAHHVIVTVPLGFLKEHQDTFFEPPLPAK
KAEAIKKLGFGTNNKIFLEFEEPFWEPDCQFIQVVWEDTSPLQDTALSLQDTWFKKLIGF
LVQPSFESSHVLCGFIAGLESEFMETLSDEEVLLSLTQVLRRVTGNPQLPAAKSVRRSQW
HSAPYTRGSYSYVAVGSTGDDLDLMAQPLPEDGTGTQLQVLFAGEATHRTFYSTTHGALL
SGWREADRLVSLWDSQVEQSRPRL
NT seq 1515 nt   +upstreamnt  +downstreamnt
atggcgttccctggcccgcgggtgctggtggtgggcagcggcatcgcggggctgggcgct
gcgcagaagctctgcagccaccgggctgctccacacctgcgggttctggaggccaccgcc
agcgccgggggccgcatccgctcggaacgctgcttcggtggtgtagtggagctgggtgca
cactggatccatgggccctcccaggacaatcctgtcttccagctggctgcagaattcggg
ctcctgggggagaaagaattatcggaagagaaccagcttgtggatacaggagggcacgtg
gccctgccctccatgatctggtccagctctggaacaagtgtgagcctggagctgatgaca
gagatggcccgtctgttctatggactgatagagcggacccgagaattcctgaatgaatct
gaaaccccaatggccagtgttggagagttcctgaagaaggagataagtcagcaggtggct
agctggaccgaggatgatgaggacaccagaaagcgcaagctggctatcctgaatactttc
ttcaacatagagtgttgtgtgagcggcacccacagcatggacctggtggctcttgcaccg
ttcggggagtatacagtgctgcctgggctggattgcatcttggctggtggctaccaagga
cttaccgaccgcatactggcttccttgcccaaggatacggtcgcttttgacaagccggtg
aagaccattcactggaatgggtccttccaggaagctgcttttccaggggagaccttcccc
gtattggtggagtgtgaagatggtgcccgcctgcctgcacatcatgtcattgtcacagtg
ccattaggttttcttaaagaacaccaagataccttttttgagccaccactgcctgccaaa
aaagcagaagccatcaaaaaactaggctttggtaccaacaacaaaatcttcttggagttt
gaagagcccttctgggagcccgactgccagttcatccaggtggtgtgggaagatacatcg
cccttacaggacacagccctctcactccaagacacctggttcaagaagctcattggattt
ttggtccagccttcttttgagtcttcacatgtgctctgtgggtttattgctgggctggag
tcggagtttatggagactctgtcagatgaagaagtgcttctgtctctaacccaagtactc
cggagagtgacaggaaacccacaattgccagcagccaagagcgtacgaaggtctcagtgg
cacagtgccccgtacacccgaggttcctacagctatgtggctgtgggcagcactggcgat
gacctagatctgatggctcagcccctccctgaagatggaactggcacccagctccaggta
ctctttgctggggaagccacacatcggacattttattctaccacacatggggccctcctg
tctggctggagagaagctgatcgcctcgttagtctgtgggactcacaggtggagcagtcg
cggcccaggctgtga

DBGET integrated database retrieval system