KEGG   Mus musculus (house mouse): 212516
Entry
212516            CDS       T01002                                 
Symbol
Efcab12
Name
(RefSeq) EF-hand calcium binding domain 12
Organism
mmu  Mus musculus (house mouse)
SSDB
Motif
Pfam: EF-hand_8
Other DBs
NCBI-GeneID: 212516
NCBI-ProteinID: NP_001103976
MGI: 2681834
Ensembl: ENSMUSG00000030321
UniProt: V9GXH0 I6L9E6
Position
6:complement(115787690..115815536)
AA seq 673 aa
MRSILKKRPGEETVSCLPPNKCLAKVCNLRGGGYKQTRRVGCQKTHALRKPPPHPSNASQ
WDAGLSSHLSKAHSQNVAETLAKHSGKQKKSSRLWEAQKAEERKSRVTFGLTITDAGSHH
SFTSIEDDLDETTSKVPVFKPELVTAHCFRQLKQKDFRLPKSRRRIIIVPGTKDQVPARP
TVPPEAPLPLMPSFRVLDTSDTQELPVDKKVWLNQRAKLRRQLETFGDVKTWLDNKPNIT
SSEFRVLSMIRQEQKTPKHTLISIRRAKDRALRHVRLIAPQLRLPKPPVLSDMYAYLRSR
KIKILEIFSKGERGENQRISREEFLMALKAVGVPLKNQELEDIIIYLGSLGKQNTITTEA
LASTYKQWSLAQQKSTIPSAKEYYKLSAKRTPLKHSPKEQQATSSSQPRKMDLLKVPEVD
TKMEGRPMSEEDMEDVGRRYRERRRQYKLSLPSIQYMENCRLVRSGTKEFDNHCLPTTIS
GEMEELLNVTRRDNFLVYLQCWELCEAYGLPLTEEILMRALLYPGDKIITLKEEVRPIRQ
PGGYYIDQRIVYSLAARRSPRRHGGKKRDKKTSKKMKKMHFDDFEELTGKLKLQRLSPSD
THPNHFWPGHLLDKLRLYLPTVAKDQSLAIFSCVEHKPPAYPAIYHSKNYWPMKDFSYMT
HAYYDANKVYSIN
NT seq 2022 nt   +upstreamnt  +downstreamnt
atgcgttctatattgaaaaagagacctggagaggagacagtcagctgtctgcccccaaac
aagtgcttggcaaaggtttgcaatttgagaggtggagggtacaaacaaacaagaagagtt
ggatgccagaagacccatgctctccgaaaacctcctccccacccatctaatgcttcgcag
tgggatgctggtctctctagccacctttccaaagcacacagtcagaatgtggcagaaacc
ctggccaaacatagtgggaagcaaaagaaatcatccaggttatgggaggcccagaaagcc
gaggagagaaaaagtcgtgtgactttcggcttgacgatcacagacgctgggtcccaccac
tctttcacctccatagaagatgacctcgatgaaaccaccagcaaggttcctgtcttcaaa
cctgagctagtcactgcccattgcttcaggcagttgaagcagaaagacttccgcctgcca
aagagccgccggaggatcatcattgtgcctggcacaaaggaccaagtgccagcccggccc
acagttccgcctgaagctcccctcccactcatgcctagcttcagagttctggatactagc
gacacccaggagctaccagtggacaagaaggtctggctgaatcagagggcaaagcttcgg
aggcagctggagacattcggtgatgtcaagacatggctggacaataagcccaacatcaca
tcatcagagttcagggttctgtccatgattcgccaggagcagaaaaccccaaaacatacc
ttgatttcaatcaggagagccaaggacagagctctcagacatgtccgcctaattgcacca
cagctgcggctgcctaagccccctgtcctgtctgacatgtacgcctaccttcgtagtcga
aagatcaagatcctagagatatttagcaagggggagcggggcgagaaccagcgcatctcc
agggaggaatttctcatggctctgaaggcggtaggagttcctctgaagaaccaagagctg
gaggacatcatcatctacctcggctctcttggcaagcagaacaccatcaccacagaagcc
ctggccagtacctacaagcagtggtcactggcccagcagaaaagcaccatacctagtgcc
aaggagtattacaaattgtctgcaaagagaactcccctgaagcacagccctaaagagcag
caagctacttcatcctcacagcctcgcaagatggacctgctgaaggtgcctgaggttgat
acaaagatggaggggcggcccatgtcagaggaagacatggaggatgtgggcagacggtac
cgagagaggcggaggcagtacaagctctctctcccctccattcaatacatggagaactgc
cgcctggttcgatctgggacgaaagagtttgacaatcactgcctgccgactaccatctct
ggggagatggaggagctgctcaatgtgacccgcagggataacttcctggtctacctgcag
tgctgggaactctgtgaggcctatgggctcccgctgactgaagagatcctcatgagagca
ctgctgtatccaggagacaagatcattactctgaaagaagaagtccgcccaatccggcag
cctggaggctattatatagaccagaggattgtctacagcctggctgcacgcaggagcccc
cgcaggcatgggggaaagaagagagacaagaagacatcaaagaaaatgaagaaaatgcac
tttgacgatttcgaggaattaactgggaagctgaagttgcagaggttaagcccctcagac
acccatcccaatcacttctggcccggtcaccttctggacaagctgaggctctacctgcct
actgtggccaaggaccagagcctggcgatcttcagctgtgtggaacacaagccccctgct
taccctgccatttaccactctaagaactactggcccatgaaagacttttcttatatgacc
catgcctattatgatgcaaacaaggtgtactccatcaactag

DBGET integrated database retrieval system