KEGG   Mus musculus (mouse): 212528
Entry
212528            CDS       T01002                                 

Symbol
Trmt1, 6720406L13Rik, 6720477L24, D8Ertd812e
Name
(RefSeq) tRNA methyltransferase 1
  KO
K00555  tRNA (guanine26-N2/guanine27-N2)-dimethyltransferase [EC:2.1.1.215 2.1.1.216]
Organism
mmu  Mus musculus (mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:mmu03016]
    212528 (Trmt1)
Enzymes [BR:mmu01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.215  tRNA (guanine26-N2/guanine27-N2)-dimethyltransferase
     212528 (Trmt1)
    2.1.1.216  tRNA (guanine26-N2)-dimethyltransferase
     212528 (Trmt1)
Transfer RNA biogenesis [BR:mmu03016]
 Eukaryotic type
  tRNA modification factors
   Methyltransferases
    212528 (Trmt1)
SSDB
Motif
Pfam: TRM zf-CCCH Met_10 Torus Cons_hypoth95 zf_CCCH_4 Methyltransf_15 Methyltransf_25
Other DBs
NCBI-GeneID: 212528
NCBI-ProteinID: NP_001158031
MGI: 1289155
Ensembl: ENSMUSG00000001909
Vega: OTTMUSG00000022183
UniProt: Q3TX08 A0A0R4IZW7
Position
8 C3; 8 41.02 cM
AA seq 663 aa
MSLARTILWLSRPLRPAHSLCRAQFMERKAQKPPSPPAMENGTRSWEERPPADPVATVTE
GAAKIVFPSANEVFYNPVQEFNRDLTCAVITEFARIHLGAKGIQIKVPGEKDSEKIAVDL
SDQEEETAGKNENLAPGDWPRTAAVGEICEEGLRVLEGLAASGLRSIRFALEVPGLQSVV
ANDASARAVELMHRNVELNGVAHLVQPNQADARMLMYQHQKAPERFDVIDLDPYGSPAPF
LDAAVQAVSDGGLLCVTCTDMAVLAGNSGETCYSKYGAMALKSRACHEMALRIVLHSLDL
HANCYQRYIVPLLSISADFYIRVFVRVFTGQAKVKSSASKQALVFQCVGCGAFYLQRLGK
ASGDPGGRIKFSAACGPPVTPECEHCGQRHQLGGPMWAEPIHDLDFVGRVLDAVTTNPGR
FHTSMRIQGVLSVVTEELPDVPLYYTLDQLSSTIHCNTPRLLQLRSALLHAGFRVSLSHA
CKNAVKTDAPPEALWDIMRCWEKECPVKRERLSESSPAFRILAVEPRLKANFNIREDANP
SSRQRGLKRFQANPEANWGPRPRARPGGKAASEDLAGRRRLLQNKRKEPAEDPAQRAARL
KTFPCKRFKEGTCQLGDQCCYSHSPAAPVASGDIPIEECPETTTKISPGPKAAAGGIPGP
GVD
NT seq 1992 nt   +upstreamnt  +downstreamnt
atgtccctcgcgaggacgatcctgtggctaagccgtcctctccgtccggcccacagcctc
tgtagagctcagttcatggaacggaaggcccagaagcctccctctccaccagcgatggag
aacggcacccggtcctgggaagagcgcccacccgcggacccggttgcgactgtcactgag
ggcgccgccaaaatcgtctttcccagtgctaacgaggttttctataacccggtgcaggaa
ttcaaccgggacctgacgtgtgctgtgatcacagagtttgctcgaattcatcttggggcc
aagggaatccagatcaaggttccaggagagaaggactcagagaaaatagctgtggacttg
tctgatcaagaagaggaaacagctggaaagaatgaaaatctggccccaggggactggcca
cggactgctgcagtgggtgagatctgtgaggaaggtctacgagtgctggaaggcctggca
gcttccggtctgcgctccatccgttttgccctggaggttcctggcctccagtctgtggtt
gccaatgatgcctctgcccgggctgtagagcttatgcacagaaatgtggagctcaatggt
gtggcacatcttgttcagcccaaccaggcagatgcccggatgctgatgtaccaacaccaa
aaggcacctgagcgatttgatgtcattgacctggacccctatggcagccccgcccccttc
ctggatgcagcagtgcaggctgtgagtgatggaggacttctgtgtgtcacctgcacagac
atggcagtcctggcggggaacagcggagagacatgctacagcaagtatggggccatggcc
ctcaagagccgagcctgccatgaaatggccctgcggattgtgctgcacagcctggacctg
cacgccaactgctaccagcgctatatcgtgccgctgctcagcatcagtgctgacttctat
atccgggtctttgtacgtgttttcacaggccaggccaaggttaagtcctcagccagcaaa
caggccctggtgttccagtgtgtgggttgtggagccttctacctgcaacgccttggcaaa
gcatcaggagaccctggtggcaggatcaagttctctgcagcctgtggtcctccagtaact
cccgagtgtgagcactgtggacagagacaccagcttgggggccccatgtgggcagagccc
atccatgacctggactttgtgggccgagttcttgacgcagtgaccacgaatcctggccgc
ttccacacttccatgaggatccaaggcgtcctcagtgttgttactgaggaacttcctgat
gtccctctctactacacactggaccaactgagcagcactatccactgcaacacaccccgc
cttctgcagcttcggtcagctctccttcatgctggtttccgagtctctctctcccatgct
tgtaagaatgcagtgaagacagatgctccccctgaggccctctgggacatcatgcgttgc
tgggaaaaggaatgtccagtgaaacgggagcggctgtctgaaagcagtccagcattccga
attcttgctgtggagcccaggctgaaggccaacttcaacatccgggaagacgccaacccc
agctcccgccagcgaggacttaagcgcttccaggccaatccagaagccaactggggtccc
cggccccgtgcccggccagggggcaaggcagcaagtgaagatctagcagggaggcggagg
ctgctacagaataagaggaaggagccagctgaggacccggcccagcgtgcagctcgcctt
aagacatttccttgcaaacgattcaaagagggtacctgtcaactaggggaccagtgctgt
tattcacacagtcctgcagctcctgtggcctctggtgatatccccatcgaagaatgtcca
gagactaccaccaagatctcccctggaccaaaggctgctgctgggggtattcctgggcca
ggtgtagactga

DBGET integrated database retrieval system