KEGG   Mus musculus (mouse): 212541
Entry
212541            CDS       T01002                                 

Gene name
Rho, Noerg1, Opn2, Ops, RP4
Definition
(RefSeq) rhodopsin
  KO
K04250  rhodopsin
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04744  Phototransduction
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09150 Organismal Systems
  09157 Sensory system
   04744 Phototransduction
    212541 (Rho)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:mmu04030]
    212541 (Rho)
G protein-coupled receptors [BR:mmu04030]
 Rhodopsin family
  Vision
   Opsin
    212541 (Rho)
SSDB
Motif
Pfam: 7tm_1 Rhodopsin_N 7TM_GPCR_Srv 7TM_GPCR_Srw 7TM_GPCR_Srsx TAS2R
Other DBs
NCBI-GeneID: 212541
NCBI-ProteinID: NP_663358
MGI: 97914
Ensembl: ENSMUSG00000030324
Vega: OTTMUSG00000056681
UniProt: P15409
Position
6 E3; 6 53.72 cM
AA seq 348 aa
MNGTEGPNFYVPFSNVTGVVRSPFEQPQYYLAEPWQFSMLAAYMFLLIVLGFPINFLTLY
VTVQHKKLRTPLNYILLNLAVADLFMVFGGFTTTLYTSLHGYFVFGPTGCNLEGFFATLG
GEIALWSLVVLAIERYVVVCKPMSNFRFGENHAIMGVVFTWIMALACAAPPLVGWSRYIP
EGMQCSCGIDYYTLKPEVNNESFVIYMFVVHFTIPMIVIFFCYGQLVFTVKEAAAQQQES
ATTQKAEKEVTRMVIIMVIFFLICWLPYASVAFYIFTHQGSNFGPIFMTLPAFFAKSSSI
YNPVIYIMLNKQFRNCMLTTLCCGKNPLGDDDASATASKTETSQVAPA
NT seq 1047 nt   +upstreamnt  +downstreamnt
atgaacggcacagagggccccaatttttatgtgcccttctccaacgtcacaggcgtggtg
cggagccccttcgagcagccgcagtactacctggcggaaccatggcagttctccatgctg
gcagcgtacatgttcctgctcatcgtgctgggcttccccatcaacttcctcacgctctac
gtcaccgtacagcacaagaagctgcgcacacccctcaactacatcctgctcaacttggcc
gtggctgacctcttcatggtcttcggaggattcaccaccaccctctacacatcactccat
ggctacttcgtctttgggcccacaggctgtaatctcgagggcttctttgccacacttgga
ggtgaaatcgccctgtggtccctggtggtcctggccattgagcgctacgtggtggtctgc
aagccgatgagcaacttccgcttcggggagaatcacgctatcatgggtgtggtcttcacc
tggatcatggcgttggcctgtgctgctcccccactcgttggctggtccaggtacatccct
gagggcatgcaatgttcatgcgggattgactactacacactcaagcctgaggtcaacaac
gaatcctttgtcatctacatgttcgtggtccacttcaccattcctatgatcgtcatcttc
ttctgctatgggcagctggtcttcacagtcaaggaggcggctgcccagcagcaggagtca
gccaccactcagaaggcagagaaggaagtcacccgcatggttatcatcatggtcatcttc
ttcctgatctgctggcttccctacgccagtgtggccttctacatcttcacccaccagggc
tccaacttcggccccatcttcatgactctgccagctttctttgctaagagctcttccatc
tataacccggtcatctacatcatgttgaacaagcagttccggaactgtatgctcaccacg
ctgtgctgcggcaagaatccactgggagatgacgacgcctctgccaccgcttccaagacg
gagaccagccaggtggctccagcctaa

DBGET integrated database retrieval system