KEGG   Mus musculus (house mouse): 212627
Entry
212627            CDS       T01002                                 
Symbol
Prpsap2, A230054F23Rik, PAP41
Name
(RefSeq) phosphoribosyl pyrophosphate synthetase-associated protein 2
Organism
mmu  Mus musculus (house mouse)
SSDB
Motif
Pfam: Pribosyl_synth Pribosyltran_N Pribosyltran UN_NPL4 SWC7
Other DBs
NCBI-GeneID: 212627
NCBI-ProteinID: NP_001157714
MGI: 2384838
Ensembl: ENSMUSG00000020528
UniProt: Q8R574 Q5SWZ0
Position
11:complement(61620476..61652924)
AA seq 369 aa
MFCVAPPELETKMNITKGGLVLFSANSNSSCMELSKKIAERLGVEMGKVQVYQEPNRETR
VQIQESVRGKDVFIIQTISKDVNTTIMELLIMVYACKTSCAKSIIGVIPYFPYSKQCKMR
KRGSIVSKLLASMMCKAGLTHLITMDLHQKEIQGFFNIPVDNLRASPFLLQYIQEEIPDY
RNAVIVAKSPASAKRAQSFAERLRLGIAVIHGEAQDAESDLVDGRHSPPMVRSVAAIHPS
LEIPMLIPKEKPPITVVGDVGGRIAIIVDDIIDDVDSFLAAAETLKERGAYKIFVMATHG
LLSSDAPRLIEESAIDEVVVTNTIPHEIQKLQCPKIKTVDISMILSEAIRRIHNGESMSY
LFRNIGLDD
NT seq 1110 nt   +upstreamnt  +downstreamnt
atgttttgtgtggcgcctcctgaattagaaaccaagatgaacataaccaaaggaggcctc
gtgttgttttcagcaaattccaattcatcatgtatggagctttcaaagaaaattgctgag
cggctgggggtggagatgggcaaagtgcaggtttaccaggaacctaacagagaaacaaga
gttcaaatccaggagtctgtgagaggaaaagatgtatttatcatccaaaccatctcaaag
gacgtgaacaccaccatcatggagctgctgatcatggtatatgcatgtaagacctcatgt
gccaagagcatcatcggagtgatcccctactttccttatagcaagcaatgcaaaatgaga
aaaaggggctccattgtctcaaaattgctggcttctatgatgtgcaaagctggtctgact
catctcatcactatggatttacaccagaaggaaatccagggcttcttcaatattccagtg
gataatttaagagcctccccattcctgttacaatatattcaagaagagatcccagattat
aggaatgcagtcatcgtggccaagtctccagcctcagccaagagggcacaatcttttgca
gagcgtctacgtctgggaatcgcagtgatccatggagaagcacaggatgctgagtctgac
ttggtggatggccggcactccccaccaatggtcaggagtgtagctgccatccatcccagc
ctggagatcccgatgctgattcctaaagagaagcccccaatcacagttgttggtgatgtt
ggaggaagaatcgccatcattgtggatgacattattgatgatgtggatagctttcttgct
gcagcagagaccctgaaggaaagaggtgcatacaagatctttgtgatggccactcacggc
ttgttatcctctgatgctccccggctgattgaagagtctgccattgatgaggtggtggtc
actaacacgatcccacacgagatccagaagctgcagtgccccaagatcaagactgtggac
atcagcatgatcctctcagaagccatccgccgaattcacaacggggagtccatgtcctac
cttttcagaaacataggcttagatgactga

DBGET integrated database retrieval system