KEGG   Mus musculus (house mouse): 212679
Entry
212679            CDS       T01002                                 
Symbol
Mars2, C730026E21Rik, MetRS
Name
(RefSeq) methionine-tRNA synthetase 2 (mitochondrial)
  KO
K01874  methionyl-tRNA synthetase [EC:6.1.1.10]
Organism
mmu  Mus musculus (house mouse)
Pathway
mmu00450  Selenocompound metabolism
mmu00970  Aminoacyl-tRNA biosynthesis
mmu01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00450 Selenocompound metabolism
    212679 (Mars2)
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    212679 (Mars2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:mmu01007]
    212679 (Mars2)
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:mmu03016]
    212679 (Mars2)
Enzymes [BR:mmu01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.10  methionine---tRNA ligase
     212679 (Mars2)
Amino acid related enzymes [BR:mmu01007]
 Aminoacyl-tRNA synthetase
  Class I (U)
   212679 (Mars2)
Transfer RNA biogenesis [BR:mmu03016]
 Eukaryotic type
  Aminoacyl-tRNA synthetases (AARSs)
   Multi-aminoacyl-tRNA synthetase complex (MSC)
    212679 (Mars2)
 Prokaryotic type
   Other AARSs
    212679 (Mars2)
SSDB
Motif
Pfam: tRNA-synt_1g tRNA-synt_1 tRNA-synt_1e Anticodon_3 Anticodon_1 D123 tRNA-synt_1f PP1
Other DBs
NCBI-GeneID: 212679
NCBI-ProteinID: NP_780648
MGI: 2444136
Ensembl: ENSMUSG00000046994
UniProt: Q499X9 A2RT28
Position
1:55276336..55279217
AA seq 586 aa
MLRQCARWVLTRTRFGRGCRRYGSCSPSASGDAGEARAYFTTPIFYVNAAPHIGHLYSAL
LADALCRHRRLRVPGSASTRFSTGTDEHGLKIQQAAATAGLAPIELCDRVSAQFLQLFRE
ADISSTDFIRTTEARHRVAVQHFWGVLEARGLLYKGIYEGWYCASDECFLPEAKVTRQVG
PSGDPCPVSLESGHPVSWTKEENYIFKLSQFREPLQRWLGNNPQAITPEPFHQAVLQWLE
EELPDLSVSRRSSHLHWGIPVPGDDSQTIYVWLDALVNYLTVVGYPDADFKSWWPATSHI
IGKDILKFHAIYWPALLLGAGLRPPHRIYVHSHWTVSGQKMSKSLGNVVDPRTCLDRYTV
DGFRYFLLRQGVPNWDCDYYDEKVVKLLDSELADALGGLLNRCTAYRINPSGTYPSFCAA
CFPSEPGLTGPSVRVQAEDYALVTAVATLPKLVAGYYNDFQIYKALEAVSSCVRQTNGFV
QRHAPWKLNWESPEDAPWLGTVLHVALECLRVFGTLLQPVTPNLADKLLSRLGVSTTERG
LGELYFLPRFYGHPCPFEGRKLGPDTGLLFPRLDQSRTRLVKAHRT
NT seq 1761 nt   +upstreamnt  +downstreamnt
atgctgcggcagtgtgctcgctgggtgttgacgcgcacccggttcggccgcggctgtcgc
cgctacggttcgtgctcgccgagcgctagtggcgacgccggggaagcgcgggcctacttc
accacacctatcttctacgtgaacgccgcgccgcacatcgggcacctgtactcggcgcta
ctggccgacgccctgtgccgccaccgtcgtctccgagttcccggctctgcgtccacgcgg
ttttccaccggcacggatgagcacggcctgaagatccagcaggcggcagccaccgccggc
ttggccccgatcgagctgtgcgatcgagtgtctgcccagtttttgcagcttttccgggag
gctgacatctcttccacggacttcatccgcaccacggaggctcggcaccgagtagcggtg
cagcatttctggggtgtgctggaggcccggggtctgctttacaaagggatctatgaaggg
tggtattgtgcctcggatgagtgcttcttgccggaggccaaggttactcggcaggtgggt
ccgtccggggatccctgtcccgtgtctctcgagagcggacatcctgtctcctggacgaag
gaagaaaattacattttcaagctttctcagtttcgagaaccactccagcggtggcttgga
aacaatcctcaggcaatcacaccggaaccgttccaccaggcagttcttcagtggctggag
gaggagctgcccgacttgtccgtttctcgaaggagtagccatctgcactggggcatacca
gttcccggggacgactcgcagaccatctacgtgtggctggatgccctggtcaactacctc
actgtagttggctacccagatgcagatttcaagtcttggtggccagccacctctcatatc
ataggtaaggacattctcaaatttcatgctatttattggcctgcccttctcctaggggca
ggattgaggccaccacatcgcatctatgtccactcgcactggacggtgagtggccaaaaa
atgtccaaaagcttgggcaacgtggtggatcccaggacttgccttgatcgctatactgtg
gatggctttcgctactttctccttcggcagggcgttcccaattgggactgcgattactat
gatgaaaaggtggttaaattgctggactccgagctggcagatgccttaggagggctttta
aaccggtgcactgcctacagaataaatccttctggaacctacccatctttctgtgctgcc
tgtttccccagtgagccagggttaacggggccgtcagttcgtgtgcaggcagaagactat
gcgcttgtaactgcagtggccactttacccaaactggtagcgggctattataatgacttt
cagatctataaggctctggaggcggtatccagctgtgttcggcaaactaatggtttcgtc
caaaggcacgcaccatggaaattgaactgggagagccctgaggatgctccctggctgggt
accgtgcttcacgtagccttggagtgcttgcgagtgtttggaactttgcttcagcctgtt
actccaaacttagcagataaactgctgtcaagactgggagtctctaccacagagagaggc
cttggagagctctacttcctacctcgattctatggacacccatgcccctttgaggggaga
aagttgggacctgacactgggcttttgtttcctagactggaccaatctaggactcggcta
gtgaaagcccacaggacctag

DBGET integrated database retrieval system