KEGG   Mus musculus (mouse): 212772Help
Entry
212772            CDS       T01002                                 

Gene name
Arl14ep, 2700007P21Rik, 4930448O08Rik, ARF7EP
Definition
(RefSeq) ADP-ribosylation factor-like 14 effector protein
Organism
mmu  Mus musculus (mouse)
SSDB OrthologParalogGFIT
Motif
Pfam: ARF7EP_C
Motif
Other DBs
NCBI-GeneID: 212772
NCBI-ProteinID: NP_001020273
MGI: 1926020
Ensembl: ENSMUSG00000027122
Vega: OTTMUSG00000015044
UniProt: Q8BIX3
Position
2; 2 E3
AA seq 276 aa AA seqDB search
MDPCSVGVQLRTTHDCHKTFYTRHTGFKTLKELSSNDMLLLQLRTGMTLSGNNTICLHHV
KIYIDRFEDLQKSCCDPFNIHKKLAKKNLHVIDLDDATFLSAKFGRQLVPGWKLCPKCTQ
IINGSVDVDSDDRQRRKPDSDGRTAKALRSLQFTNPGKQTEFAPEGGKREKRKLTKATSA
ASDRQIIPAKSKVYDSQGLLIFSGMDLCDCLDEDCLGCFYACPTCGSTKCGAECRCDRKW
LYEQIEIEGGEIIHNKHAGKAYGLLSPCHPYDILQK
NT seq 831 nt NT seq  +upstreamnt  +downstreamnt
atggatccgtgttcagttggagtccagcttcgtaccacacacgactgccataaaaccttc
tatactcggcacacaggtttcaagacattgaaagaattgtcatcaaatgacatgctttta
cttcagcttagaactggaatgacactttctgggaataatacaatttgtctccatcacgta
aaaatttatattgacagatttgaagatttgcagaagtcgtgttgtgacccatttaacata
cacaagaagctagccaaaaagaacctgcacgtcattgacttagatgatgccacttttctg
agcgccaagtttggaagacagcttgtacctggttggaagctttgccccaaatgtacccag
atcatcaatggaagtgtggacgttgattcagatgaccgccagagacggaaacccgactca
gatggaaggactgctaaagctctgaggtcactacagtttacaaacccagggaagcaaact
gaatttgctccagaaggcggtaagagggagaaaagaaagctcaccaaagccacaagcgct
gcttctgacagacaaattattccagcaaagagtaaggtgtatgacagccagggcctgctg
attttcagtggcatggacctctgcgactgcctggacgaggactgcttgggatgcttctac
gcttgccccacttgtggctctaccaaatgtggggctgagtgccgctgcgaccgaaagtgg
ctgtatgagcagatagagattgaaggaggagagataatccataataaacatgctggaaaa
gcatatggtctgttatctccctgtcacccatatgatattttacaaaaatga

DBGET integrated database retrieval system