KEGG   Mus musculus (mouse): 212880Help
Entry
212880            CDS       T01002                                 

Gene name
Ddx46, 2200005K02Rik, 8430438J23Rik, AI325430, AI957095, mKIAA0801
Definition
(RefSeq) DEAD (Asp-Glu-Ala-Asp) box polypeptide 46
  KO
K12811  ATP-dependent RNA helicase DDX46/PRP5 [EC:3.6.4.13]
Organism
mmu  Mus musculus (mouse)
Pathway
mmu03040  Spliceosome
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09120 Genetic Information Processing
  09121 Transcription
   03040 Spliceosome
    212880 (Ddx46)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03041 Spliceosome [BR:mmu03041]
    212880 (Ddx46)
Enzymes [BR:mmu01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.13  RNA helicase
     212880 (Ddx46)
Spliceosome [BR:mmu03041]
 Complex A
  U2 snRNP components
   U2 related factors
    212880 (Ddx46)
 Complex B
    212880 (Ddx46)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DEAD Helicase_C CdAMP_rec
Motif
Other DBs
NCBI-GeneID: 212880
NCBI-ProteinID: NP_001268984
MGI: 1920895
Ensembl: ENSMUSG00000021500
UniProt: Q569Z5
Position
13; 13 B1
AA seq 1032 aa AA seqDB search
MGRESRHYRKRSASRGRSGSRSRSRSPSDKRSKRGDDRRSRSRDRDRRRERSRSRDKRRS
RSRDRKRLRRSRSRERDRSRERRRSRSRDRRRSRSRSRGRRSRSSSPGSKTKKTENRSRS
KEKAEGGDSSKEKKKDKDDKEDEKEKDAGNFDQNKLEEEMRKRKERVEKWREEQRKKAME
NIGELKKEIEEMKQGKKWSLEDDDDDEDDPAEAEKEGTEMEDEELDPLDAYMEEVKEEVK
KFNMRSVKGGAGNEKKSGPTVTKVVTVVTTKKAVVDADKKKGELMENDQDAMEYSSEEEE
VDLQTALTGYQTKQRKLLEPVDHGKIEYEPFRKNFYVEVPELAKMSQEEVNVFRLEMEGI
TVKGKGCPKPIKSWVQCGISMKILNSLKKHGYEKPTPIQTQAIPAIMSGRDLIGIAKTGS
GKTIAFLLPMFRHIMDQRSLEEGEGPIAVIMTPTRELALQITKECKKFSKTLGLRVVCVY
GGTGISEQIAELKRGAEIIVCTPGRMIDMLAANSGRVTNLRRVTYVVLDEADRMFDMGFE
PQVMRIVDNVRPDRQTVMFSATFPRAMEALARRILSKPIEVQVGGRSVVCSDVEQQVIVI
EEEKKFLKLLELLGHYQESGSVIIFVDKQEHADGLLKDLMRASYPCMSLHGGIDQYDRDS
IINDFKNGTCKLLVATSVAARGLDVKHLILVVNYSCPNHYEDYVHRAGRTGRAGNKGYAY
TFITEDQARYAGDIIKALELSGTAVPPDLEKLWSDFKDQQKAEGKIIKKSSGFSGKGFKF
DETEQALANERKKLQKAALGLQDSDDEDAAVDIDEQIESMFNSKKRVKDMAAPGTSSVPA
PTAGNAEKLEIAKRLALRINAQKNLGIESQVDVMQQATNAILRGGTILAPTVSAKTIAEQ
LAEKINAKLNYVPLEKQEEERQEGGQSESFKRYEEELEINDFPQTARWKVTSKEALQRIS
EYSEAAITIRGTYFPPGKEPKEGERKIYLAIESANELAVQKAKAEITRLIKEELIRLQNS
YQPTNKGRYKVL
NT seq 3099 nt NT seq  +upstreamnt  +downstreamnt
atgggccgggagtctcgccactaccgaaaacgctcagcatctcgaggtcgttctggaagt
cgatcgaggagtcgctcaccctctgacaaaagaagcaaacgtggggatgacagacgctct
cggagcagagacagagaccggaggagagagaggtctcggagtagggacaagagaagatct
cggtcaagggacaggaagcgcctgaggcgctccagaagtagagagcgagacagaagccga
gagcggagaagatctcggagcagagatagaaggcgctcaaggagtcgaagccggggcagg
cggtcccggtcctccagtcctggcagcaaaaccaagaagactgagaacaggtctaggtcc
aaagagaaagcagaaggtggggacagctccaaggagaagaaaaaggacaaggatgacaag
gaggacgagaaagagaaggatgctgggaactttgaccagaataaactggaagaagaaatg
agaaaacggaaagaaagagttgaaaaatggcgcgaagagcagcgtaagaaggctatggag
aacataggagagctgaagaaggagattgaggagatgaagcaggggaagaagtggagcttg
gaggacgacgacgatgatgaagatgatcctgccgaggctgagaaggaagggactgaaatg
gaggacgaggagctggacccattagacgcctacatggaagaagtgaaggaagaggtaaaa
aagtttaacatgaggagcgtgaaaggcggcgcaggaaatgagaagaagtctgggccaaca
gtcacaaaagttgtcactgtggtgaccaccaagaaagcagtagtagacgcggataagaag
aagggggaactcatggagaatgaccaggacgccatggagtattcctcagaggaggaggaa
gttgaccttcaaacggccctcacaggctaccagacaaaacagagaaaacttctagagcca
gttgatcatggaaaaattgaatatgagccattcagaaaaaacttttatgttgaagttcca
gaattagcaaaaatgtctcaagaagaggtgaatgtgtttcgattggaaatggagggcatt
acagttaaaggaaaaggttgcccgaaaccaattaaatcatgggtccagtgtggaatttcc
atgaagatactaaattccctcaaaaagcatggctatgaaaagccaacaccaatccaaact
caagcgattcctgctataatgtctggacgagatttgattggcattgccaagacaggaagt
ggaaaaaccattgcttttcttttgcccatgtttagacacatcatggatcagaggtcatta
gaagaaggagagggaccaatagctgtcatcatgactccaactcgagagctggctttacaa
atcactaaagaatgtaagaagttttcgaagaccttgggactgagagtggtctgtgtgtat
ggagggacaggaatcagcgagcagattgctgagctgaaaagaggtgctgaaattattgtt
tgcacacctggtcgaatgattgacatgttagcggctaacagtggtcgggtcacaaatctt
cgaagagtgacatatgttgttttagatgaagcagacagaatgtttgacatgggttttgaa
ccacaggtcatgcgcattgtggataacgttcgtcctgaccgacagacagttatgttttca
gccactttccctagagctatggaggctttggcccgcaggatcctgagcaaacctattgaa
gtgcaggttggaggcaggagtgtggtttgctccgatgtggaacagcaggtgattgtgatt
gaagaagaaaagaaattcttgaaattgctggagcttttaggccattatcaggagtcagga
tctgtcattatatttgtggataagcaggaacacgcagatggtcttctgaaggacttgatg
agagcatcgtacccttgcatgtctcttcacggaggtattgatcaatatgacagggacagt
atcataaatgactttaagaatggaacctgcaagctcctcgttgccacatctgttgcagct
cgtggtctcgatgtgaaacatctaattcttgtagtgaattacagctgccccaatcattat
gaagattatgtgcacagagctgggcggactggaagagcgggcaacaagggttatgcctac
accttcatcacagaggatcaagctcgatatgctggtgacatcattaaagctcttgaattg
tcagggaccgcagtgcctcctgacctagaaaaactctggagtgacttcaaagatcaacag
aaagctgaaggaaaaataattaaaaagagtagtggcttctctggcaagggattcaagttt
gatgaaacagaacaggctttagccaatgagaggaaaaagctgcagaaagctgctcttggc
ctgcaagattctgatgacgaggatgctgcagttgatattgatgaacagattgaaagcatg
tttaattcaaagaagagagtaaaggacatggctgcacccggcacatccagcgtgcccgcg
cccactgcaggcaatgctgagaagctagaaatcgccaagagattggctctcagaatcaac
gctcagaagaacctgggcatcgagtctcaggtagatgtgatgcagcaggccaccaacgcc
atcctcagaggtggcactatcctggctcccactgtgtctgcgaaaaccattgcagagcag
cttgctgagaagatcaatgccaagctcaactacgtgcctttggagaagcaggaggaagag
agacaggagggtgggcagagcgagtctttcaagagatacgaggaagaattagaaattaat
gacttcccacagactgcgaggtggaaagtcacctcaaaggaagccctgcagaggatcagc
gagtactctgaggccgccatcaccatcaggggcacctacttccctcccggcaaggagccc
aaggaaggagagcgcaagatctacctggccatcgaaagtgccaacgagctggctgtgcag
aaagcaaaggcagagatcaccaggctcataaaagaggaactgatccgactgcaaaattca
taccaaccaaccaacaaaggacgatacaaagtattataa

DBGET integrated database retrieval system