KEGG   Mus musculus (mouse): 212943Help
Entry
212943            CDS       T01002                                 

Gene name
Tent5a, BAP014, D930050G01Rik, Fam46a
Definition
(RefSeq) terminal nucleotidyltransferase 5A
  KO
K23033  terminal nucleotidyltransferase 5A/B [EC:2.7.7.-]
Organism
mmu  Mus musculus (mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:mmu03019]
    212943 (Tent5a)
Enzymes [BR:mmu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.-  
     212943 (Tent5a)
Messenger RNA biogenesis [BR:mmu03019]
 Eukaryotic Type
  mRNA processing factors
   Other processing factors
    212943 (Tent5a)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: NTP_transf_7
Motif
Other DBs
NCBI-GeneID: 212943
NCBI-ProteinID: NP_001153850
MGI: 2670964
Ensembl: ENSMUSG00000032265
Vega: OTTMUSG00000045030
UniProt: D3Z5S8
Position
9; 9 E3.1
AA seq 447 aa AA seqDB search
MHQRYFWTDQGQVAFGGHYMAEGEGYFAMAEDELTGGPYIPLGGDFGGGGSSFGDRCSDY
CESPTAHCNVLNWEQVQRLDGILSETIPIHGRGNFPTLELQPSLIVKVVRRRLEEKGIGV
RDVRLNGSAASHVLHQDSGLGYKDLDLIFCADLRGEEEFQTVKDVVLDCLLDFLPEGVNK
EKITPLTLKEAYVQKMVKVCNDSDRWSLISLSNNSGKNVELKFVDSLRRQFEFSVDSFQI
KLDSLLLFYECSENPMTETFHPTIIGESVYGDFHEAFDHLCNKIIATRNPEEIRGGGLLK
YCNLLVRGFRPASEEIKTLQRYMCSRFFIDFSDIGEQQRKLESYLQNHFVGLEDRKYDYL
MTLHGVVNESTVCLMGHERRQTLNLITMLAIRVLADQNVIPNVANVTCYYQPAPYVADAN
FSNYYIAQVQPVFTCQQQTYSTWLPCN
NT seq 1344 nt NT seq  +upstreamnt  +downstreamnt
atgcatcagagatacttttggactgaccaaggccaagtggctttcggagggcactacatg
gccgagggcgaagggtactttgccatggcagaggacgagctgaccggcggcccttacatc
cccctgggtggtgacttcggcggcggcggcagcagcttcggcgaccgctgctcggactat
tgcgaaagccccacggcgcactgcaatgtgctgaactgggagcaagtgcagcggttggac
ggcattctgagcgagaccatcccgatccacgggcgcggcaacttccccacgctcgagctg
cagccaagcctgattgtgaaggtggtgaggaggcgcctggaagagaagggcataggtgtc
cgcgacgtgcgcctcaacggctcagccgccagtcacgtcctgcaccaggacagtggccta
ggctacaaggacctggacctcatcttctgcgctgacctgcgtggggaagaggagtttcag
actgtgaaggacgtcgttctggattgcctgttagacttcttgcccgaaggggtgaacaag
gagaagatcacaccgctcactctcaaggaggcttatgtgcagaaaatggttaaagtgtgc
aatgattctgaccggtggagccttatatccctgtcaaacaacagtggcaaaaatgtggag
ctgaagtttgtggattccctgcggaggcagtttgaattcagtgtagattcttttcaaatc
aaattagactctcttctcctcttttacgagtgttcagagaacccgatgactgagacattt
caccccaccatcatcggtgagagtgtctatggtgatttccacgaagcctttgatcacctt
tgcaacaagatcattgccaccaggaacccagaggaaataagagggggaggcctgcttaag
tactgcaatctcttagtgcggggcttcaggcctgcctccgaggagatcaagaccctccag
aggtacatgtgttcccggttttttattgacttctcagacatcggagagcagcagagaaag
ctggagtcctacttgcagaaccacttcgtgggcttggaagaccgcaagtatgactatctc
atgacccttcatggagtggtaaacgagagtacggtgtgcctgatgggacatgaaaggagg
cagactttaaaccttatcaccatgctggcaatccgggtgctagctgaccaaaatgtcatt
cctaatgtggctaatgtcacttgctattaccagccggccccctatgttgcagatgctaac
tttagcaattactacattgcacaagttcagcccgtgttcacatgccagcagcagacatac
tctacttggttaccctgcaactaa

DBGET integrated database retrieval system