KEGG   Mus musculus (house mouse): 213006
Entry
213006            CDS       T01002                                 
Symbol
Mfsd4a, A230072B04, A930031D07Rik, AI850289, Mfsd4
Name
(RefSeq) major facilitator superfamily domain containing 4A
Organism
mmu  Mus musculus (house mouse)
SSDB
Motif
Pfam: MFS_1
Other DBs
NCBI-GeneID: 213006
NCBI-ProteinID: NP_001108134
MGI: 2442786
Ensembl: ENSMUSG00000059149
UniProt: Q6PDC8
Position
1:complement(131947543..131997400)
AA seq 510 aa
MGCDGRVSELLRRNLQPTLTYWSVFFSFGLCIAFLGPTLLDLRCQTHSSLPQISWVFFSQ
QLCLLLGSALGGVFKRTLAQSLWALFTSTLVISLVFAVIPFCHDVKVLASVIALAGLAMG
CIDTVANMQLVRIYQKDSAFFLQVLHFFVGLGALLSPLIADPFLSEANCFPANNTANATS
RSHGSRVLSQHHAAAQPWINQTIPRLPPKEVTENHVSYAFWIMALINLPVPLAVLFLLSK
ERLLTCAQRKPLLLSADELALETRPAEKEDTSSLAPKFQPHSGQEDLFSCCQRKNFRGAP
CSFFAIHITAALVLFMTDGMMGAYSAFVYSYAVEKPLSIGHKSAGYLPSLFWGFITLGRF
ISIPVSSRMRPATMVFINVVGVVVTFLMLLIFSYNVIFLFVGTASLGLFLSSTFPSMLAY
TEDILQYKGCATTVLVTGAGIGEMVLQMLVGLIFQAQGSYSFLVCGVIFGCLAFIFYILL
LFFHRIHPELSSVLTQDKALGVENPECYQR
NT seq 1533 nt   +upstreamnt  +downstreamnt
atgggctgcgacggccgggtgtctgagctgctccgccgcaacctacagcccacgctcacc
tactggagcgtcttcttcagcttcggcctgtgcatcgccttcctggggcccacgcttctg
gacctgcgctgccagacgcacagctcgttgccccagatctcctgggtcttcttctcgcag
cagctctgcctcctgctgggcagcgccctcgggggtgtcttcaagaggaccctggcccag
tcgttatgggccctcttcacctctaccctggtcatctccctggtttttgctgtcatcccc
ttctgccatgacgtgaaggtattggcctcggtcatagcgctggcgggcctggccatgggc
tgcatcgacaccgtggccaacatgcagttggtgaggatataccagaaggactcagccttc
ttccttcaggtccttcatttcttcgtgggccttggtgctctgctgagccccctgattgcg
gaccccttcctgtcagaggccaactgctttcctgctaataacacagccaatgccacctcc
agaagccatggatcccgggtcctgagccaacatcacgcagcagcccagccttggataaac
cagacgatccccaggctgcccccaaaggaggtgaccgagaaccacgtatcctatgccttc
tggatcatggctctcatcaatctcccagtgcccctggctgttctgttcctgctgtccaag
gagcggctgctgacctgcgctcagaggaagccactgctcctgtctgcggatgagcttgca
ctggagacccggcctgctgagaaggaagacacctcctcacttgcccccaagtttcagcca
cactcagggcaggaggacctgttcagctgctgccagaggaagaacttccggggagccccg
tgctctttcttcgccatccacatcacggcagctctggtcctgttcatgacagacgggatg
atgggcgcttattcggcctttgtgtacagctatgctgtggagaagccgctctctattgga
cacaagtcagctggttacctccctagcctcttctggggtttcatcactctgggcaggttc
atctccatcccagtctcctcaagaatgaggccagccaccatggtgttcatcaatgtggtg
ggagtggtggtgaccttcctgatgctgcttatcttctcctacaatgtcatcttcctgttt
gtggggaccgcaagcctggggctgtttctcagtagcaccttccccagtatgctggcctac
accgaggacatcctccagtataaaggttgtgcgaccacagtgctggtgactggggcaggc
attggcgagatggtcctgcagatgctggttggcttgatctttcaggcccagggcagttac
agtttcctggtctgtggtgtgatctttggctgcctggcttttatcttctacatcttgctc
ctgtttttccacaggatacaccctgaactctcatcagttcttacccaagacaaagccctt
ggtgtggagaaccctgagtgctaccagaggtga

DBGET integrated database retrieval system