KEGG   Mus musculus (house mouse): 213012
Entry
213012            CDS       T01002                                 
Symbol
Abhd10
Name
(RefSeq) abhydrolase domain containing 10
  KO
K13702  abhydrolase domain-containing protein 10 [EC:3.1.1.93]
Organism
mmu  Mus musculus (house mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:mmu01002]
    213012 (Abhd10)
Enzymes [BR:mmu01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.93  mycophenolic acid acyl-glucuronide esterase
     213012 (Abhd10)
Peptidases and inhibitors [BR:mmu01002]
 Serine peptidases
  Family S9: prolyl oligopeptidase family
   213012 (Abhd10)
SSDB
Motif
Pfam: Hydrolase_4 Abhydrolase_1 Abhydrolase_6 Peptidase_S9 DUF2920 FSH1
Other DBs
NCBI-GeneID: 213012
NCBI-ProteinID: NP_766099
MGI: 2442422
Ensembl: ENSMUSG00000033157
Position
16:complement(45550088..45563355)
AA seq 297 aa
MAAWAPCRRWGWAAVSFGRHPGLSASLARKPPRAWWLSACRQKASLSFLNRSELPNLAYK
RLKGKTPGIIFIPGYLSNMNGIKAVAVEEFCKSLGHAFIRFDYSGIGSSDGNLAECTVGK
WRKDVLSILDDVAEGPQILVGSSLGGWLMLHAAIARPEKVIALIGIATAADGLVTQYHAL
PVETQKEIEMKGEWTLPSRYNKEGYFRIPYSFIKEAEHHCLLHSPIPVTCPVRLLHGMKD
EIVPWQRSLQVADRIVSPDVDVILRKQGDHRMKEKADIHLLICTIDDLIDKLSTVVP
NT seq 894 nt   +upstreamnt  +downstreamnt
atggcggcctgggccccttgtcggaggtggggctgggcggctgtgtccttcggccggcac
ccgggcctgagcgcgtcactagctcggaagcccccacgggcatggtggctctcagcttgc
agacaaaaggcatcactttctttccttaaccgatcagaacttccaaacctggcttataag
aggttaaaaggcaaaaccccaggaattatcttcatccctggctatctttctaacatgaat
ggtataaaggcagtagcagttgaggagttttgcaaatctctaggtcacgcctttataagg
tttgactactcagggattggaagttcagatggtaacttagcagagtgcacagtggggaaa
tggagaaaggatgtcctttccatacttgatgacgtagctgaaggaccgcagatactggtt
ggatccagtcttggtggatggctcatgctgcatgctgcaattgcacggccggaaaaagtc
atagctcttattggtatagctactgctgcagatggattggtgacacaatatcatgcactt
cctgttgagactcaaaaggaaatagaaatgaaaggtgagtggaccttgccatctagatac
aacaaggaaggctatttcagaatcccgtacagtttcattaaagaagcggagcatcactgc
ttgttgcatagccccatccctgtgacctgccctgtacgcttgctccacggcatgaaggat
gaaatagttccttggcagagatccctgcaggtcgcggaccgaatagtcagcccagatgta
gatgtcatcctccggaaacaaggtgatcacaggatgaaggagaaagcagatattcatctg
cttatttgtactattgatgacttgattgacaagctttcaactgtagttccgtag

DBGET integrated database retrieval system