KEGG   Mus musculus (mouse): 213019
Entry
213019            CDS       T01002                                 

Gene name
Pdlim2, 4732462F18Rik, Slim
Definition
(RefSeq) PDZ and LIM domain 2
  KO
K23353  PDZ and LIM domain protein 1/2/3/4
Organism
mmu  Mus musculus (mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99992 Structural proteins
    213019 (Pdlim2)
SSDB
Motif
Pfam: PDZ DUF4749 PDZ_6 LIM PDZ_2
Other DBs
NCBI-GeneID: 213019
NCBI-ProteinID: NP_001240665
MGI: 2384850
Ensembl: ENSMUSG00000022090
Vega: OTTMUSG00000033027
UniProt: Q8R1G6
Structure
PDB: 
1VB7

Position
14; 14 D2
AA seq 349 aa
MALTVDVAGPAPWGFRISGGRDFHTPIIVTKVTERGKAEAADLRPGDIIVAINGQSAENM
LHAEAQSKIRQSASPLRLQLDRSQTASPGQTNGEGSLEVLATRFQGSLRTHRDSQSSQRS
ACFSPVSLSPRPCSPFSTPPPTSPVALSKEDMIGCSFQSLTHSPGLAAAHHLTYPGHPTS
QQAGHSSPSDSAVRVLLHSPGRPSSPRFSSLDLEEDSEVFKMLQENRQGRAAPRQSSSFR
LLQEALEAEERGGTPAFVPSSLSSQASLPTSRALATPPKLHTCEKCSVNISNQAVRIQEG
RYRHPGCYTCADCGLNLKMRGHFWVGNELYCEKHARQRYSMPGTLNSRA
NT seq 1050 nt   +upstreamnt  +downstreamnt
atggcgttgactgtggatgtggcaggaccagcaccttggggcttccgaattagcgggggc
agagatttccacacacccatcattgtgaccaaggtcacagagcggggcaaggctgaagca
gctgatctccggcctggcgacatcattgtggccatcaatggacagagtgcagagaacatg
ctacacgcggaggcccaaagcaagatccgacagagcgcctcacccctaagactgcagctg
gaccggtcccaaacagcctctcctgggcagaccaatggggagggctccttggaagtgctg
gcaaccagattccagggctccctgaggacacaccgtgacagccagtcttcccagaggtct
gcctgcttcagcccagtctctctcagccccaggccttgcagccccttctccaccccaccc
cctaccagcccagttgccctttctaaagaggatatgattggctgtagtttccagagtctg
acacactctccaggccttgctgctgctcaccacttgacctaccctggccaccccaccagc
caacaggccggccacagcagcccaagcgactccgcagtgagggtgctgctccattcccca
ggacggccctccagccctaggttcagcagtttggatctggaggaagactcagaggtgttc
aagatgctgcaggagaaccgccagggacgggccgccccaaggcagtccagctcttttcga
ctcttacaggaagccttggaggctgaggagagaggtggcacacctgcctttgtgcccagc
tcgctgagctcccaggcttccttgcccacctccagggccttggccactccacccaagctc
cacacctgtgagaaatgcagcgtcaacatctcgaaccaggcggtccgcatccaggagggg
aggtaccgacaccctggctgctacacttgcgcagactgtgggctgaacctgaagatgcgc
ggccacttctgggtgggcaatgagttgtactgcgagaagcatgcccgccagcgctactct
atgcctggaactctcaactctcgagcctga

DBGET integrated database retrieval system