KEGG   Mus musculus (house mouse): 213019
Entry
213019            CDS       T01002                                 
Symbol
Pdlim2, 4732462F18Rik, Slim
Name
(RefSeq) PDZ and LIM domain 2
  KO
K23353  PDZ and LIM domain protein 1/2/3/4
Organism
mmu  Mus musculus (house mouse)
Pathway
mmu04820  Cytoskeleton in muscle cells
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09140 Cellular Processes
  09142 Cell motility
   04820 Cytoskeleton in muscle cells
    213019 (Pdlim2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04990 Domain-containing proteins not elsewhere classified [BR:mmu04990]
    213019 (Pdlim2)
Domain-containing proteins not elsewhere classified [BR:mmu04990]
 LIM domain-containing proteins
  PDZ-LIM family proteins
   213019 (Pdlim2)
SSDB
Motif
Pfam: PDZ DUF4749 PDZ_6 LIM PDZ_2
Other DBs
NCBI-GeneID: 213019
NCBI-ProteinID: NP_001240665
MGI: 2384850
Ensembl: ENSMUSG00000022090
UniProt: Q8R1G6
Structure
Position
14:complement(70401667..70415140)
AA seq 349 aa
MALTVDVAGPAPWGFRISGGRDFHTPIIVTKVTERGKAEAADLRPGDIIVAINGQSAENM
LHAEAQSKIRQSASPLRLQLDRSQTASPGQTNGEGSLEVLATRFQGSLRTHRDSQSSQRS
ACFSPVSLSPRPCSPFSTPPPTSPVALSKEDMIGCSFQSLTHSPGLAAAHHLTYPGHPTS
QQAGHSSPSDSAVRVLLHSPGRPSSPRFSSLDLEEDSEVFKMLQENRQGRAAPRQSSSFR
LLQEALEAEERGGTPAFVPSSLSSQASLPTSRALATPPKLHTCEKCSVNISNQAVRIQEG
RYRHPGCYTCADCGLNLKMRGHFWVGNELYCEKHARQRYSMPGTLNSRA
NT seq 1050 nt   +upstreamnt  +downstreamnt
atggcgttgactgtggatgtggcaggaccagcaccttggggcttccgaattagcgggggc
agagatttccacacacccatcattgtgaccaaggtcacagagcggggcaaggctgaagca
gctgatctccggcctggcgacatcattgtggccatcaatggacagagtgcagagaacatg
ctacacgcggaggcccaaagcaagatccgacagagcgcctcacccctaagactgcagctg
gaccggtcccaaacagcctctcctgggcagaccaatggggagggctccttggaagtgctg
gcaaccagattccagggctccctgaggacacaccgtgacagccagtcttcccagaggtct
gcctgcttcagcccagtctctctcagccccaggccttgcagccccttctccaccccaccc
cctaccagcccagttgccctttctaaagaggatatgattggctgtagtttccagagtctg
acacactctccaggccttgctgctgctcaccacttgacctaccctggccaccccaccagc
caacaggccggccacagcagcccaagcgactccgcagtgagggtgctgctccattcccca
ggacggccctccagccctaggttcagcagtttggatctggaggaagactcagaggtgttc
aagatgctgcaggagaaccgccagggacgggccgccccaaggcagtccagctcttttcga
ctcttacaggaagccttggaggctgaggagagaggtggcacacctgcctttgtgcccagc
tcgctgagctcccaggcttccttgcccacctccagggccttggccactccacccaagctc
cacacctgtgagaaatgcagcgtcaacatctcgaaccaggcggtccgcatccaggagggg
aggtaccgacaccctggctgctacacttgcgcagactgtgggctgaacctgaagatgcgc
ggccacttctgggtgggcaatgagttgtactgcgagaagcatgcccgccagcgctactct
atgcctggaactctcaactctcgagcctga

DBGET integrated database retrieval system