KEGG   Mus musculus (mouse): 213027Help
Entry
213027            CDS       T01002                                 

Gene name
Evi5l, 1700084G18Rik, 2310039H16Rik, 3110007G05Rik, B130050I23Rik
Definition
(RefSeq) ecotropic viral integration site 5 like
  KO
K20242  ecotropic viral integration site 5 protein
Organism
mmu  Mus musculus (mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:mmu04131]
    213027 (Evi5l)
Membrane trafficking [BR:mmu04131]
 Protein recycling
  Rab GTPases and associated proteins
   Rab11 associated proteins
    213027 (Evi5l)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: RabGAP-TBC
Motif
Other DBs
NCBI-GeneID: 213027
NCBI-ProteinID: NP_001034667
MGI: 2442167
Ensembl: ENSMUSG00000011832
Vega: OTTMUSG00000040168
UniProt: H3BJX1
Position
8; 8 A1.1
AA seq 406 aa AA seqDB search
MSLPTMASPTLSPDSSSQEALSAPTCSPTSDSENLSPDELELLAKLEEQNRLLEADSKSM
RSMNGSRRNSGSSLVSSSSASSNLSHLEEDTWILWGRIANEWEEWRRRKEKLLKELIRKG
IPHHFRAIVWQLLCSATDMPVKNQYSELLKMSSPCEKLIRRDIARTYPEHEFFKGQDSLG
QEVLFNVMKAYSLVDREVGYCQGSAFIVGLLLMQMPEEEAFCVFVRLMQEYRLRELFKPS
MAELGLCIYQFEYMLQEQLPDLNTHFRSQSFHTSMYASSWFLTLFLTTFPLPVATRVFDI
FMYEGLEIVFRVGLALLQVNQTELMQLDMEGMSQYFQRVIPHQFDSCPDKLVLKAYQVKY
NPKKMKRLEKEYAAMKSKEMEEQIEIKPRVGAHSPVGMSSKLATQQ
NT seq 1221 nt NT seq  +upstreamnt  +downstreamnt
atgagcctgcccaccatggcaagccccactctgagcccggactcctcatctcaagaggcc
ctgtcagcacccacctgctccccaacctctgactccgagaatctcagcccagatgagcta
gaactactggccaagctcgaggagcagaaccggctcctggaagccgactccaagtccatg
cgctccatgaatggctcccggaggaacagtggctcctcactggtatccagctcctcagcc
tcctccaacctgagccacctggaggaggacacgtggattctctggggccgaattgccaac
gagtgggaggagtggcggcgcaggaaggaaaaactactcaaggagctgatccggaagggc
atcccacaccactttcgggccatcgtctggcagctcctgtgcagtgccacagatatgccc
gtcaaaaaccagtactctgagctcctcaagatgtcctccccatgtgagaaactcatcagg
agggatattgcccgcacctacccagagcatgaattcttcaaaggccaggacagcctgggc
caggaagtcctcttcaatgtcatgaaggcatactccctggttgatcgggaggtgggctac
tgccagggcagtgccttcattgtgggcttactcctcatgcagatgcctgaggaagaggcc
ttctgtgtattcgtgcgactgatgcaggagtaccggctacgggagctcttcaagcccagc
atggccgagctgggactctgtatctaccagtttgaatacatgctacaggagcagcttccg
gacctgaatacccacttccgctcacagagcttccacacgtccatgtatgcatcgtcctgg
ttccttacgcttttccttaccaccttccccctgcctgttgccacccgggtctttgatatc
tttatgtatgagggactggagattgtgttccgagtaggccttgccctgctgcaagtgaac
cagacagagttgatgcaactggacatggagggcatgtcccagtacttccagagagtcatc
ccccaccagtttgacagctgcccagacaagctggtcctcaaggcttatcaggtcaagtac
aaccctaaaaagatgaagaggctggagaaggagtacgcagctatgaagagtaaagagatg
gaggagcagatcgagatcaaaccccgcgtgggagcgcattccccagttggcatgtcctca
aagctggccacacaacagtaa

DBGET integrated database retrieval system