KEGG   Mus musculus (house mouse): 213054
Entry
213054            CDS       T01002                                 
Symbol
Gabpb2, 1810015F01Rik, 5830427M07, 9430006E19Rik, A430024B14Rik, AV050852, Gabpb2-1
Name
(RefSeq) GA repeat binding protein, beta 2
  KO
K09454  GA-binding protein transcription factor, beta
Organism
mmu  Mus musculus (house mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:mmu03000]
    213054 (Gabpb2)
   03029 Mitochondrial biogenesis [BR:mmu03029]
    213054 (Gabpb2)
Transcription factors [BR:mmu03000]
 Eukaryotic type
  beta-Scaffold factors with minor groove contacts
   RHR (Rel homology region) Ankyrin only
    213054 (Gabpb2)
Mitochondrial biogenesis [BR:mmu03029]
 Mitochondrial quality control factors
  Regulator of mitochondrial biogenesis
   Ubiquitas transcription factors
    213054 (Gabpb2)
SSDB
Motif
Pfam: Ank_2 Ank_4 Ank_3 Ank Ank_5
Other DBs
NCBI-GeneID: 213054
NCBI-ProteinID: NP_084161
MGI: 95612
Ensembl: ENSMUSG00000038766
UniProt: P81069
Position
3:complement(95089077..95125291)
AA seq 414 aa
MSLVDLGKRLLEAARKGQDDEVRTLMANGAPFTTDWLGTSPLHLAAQYGHYSTAEVLLRA
GVSRDARTKVDRTPLHMAAADGHVHIVELLVRSGADVNAKDMLQMTALHWATEHHHRDVV
ELLIKYGADVYAFSKFDKSAFDIAMEKNNTEILVMLQEAMQNQVNTNHERANPVANPVTV
TAPFIFTSGEVINLASFVSSANTKATSAHLEEMEEGNSLDSSTQQVVGSGGQRVITIVTD
GVPLGNIQTSLPAGGIGQPFIVTMQDGQQVLTVPAGQVAEETIIEDEEEEEEKLPLVKRP
RMAEMTNRVEEMKEGSERELLQQQLQEANRRAQEYRHQLLKKEQEAEQYRLRLEAMAQQQ
TNGVEVDVTVVEEVAEVDAVVVTEGDEVERATQVMKSGRTTEPHTNVSIETISS
NT seq 1245 nt   +upstreamnt  +downstreamnt
atgtctctggtggacttggggaagaggctgctagaagctgcaaggaaaggccaagacgat
gaagtgaggacactgatggcaaatggggctccattcaccacagactggctcggaacatca
ccgcttcaccttgcagcccagtatggtcattattccacagcagaagtgctccttcgagct
ggcgttagcagggatgcccggaccaaagtggacaggacccctttgcatatggctgcagct
gatggacatgttcacatcgtggaactgcttgttaggagtggtgcagatgtgaacgcaaag
gacatgctgcagatgacagctctgcactgggccacagagcaccatcaccgggatgtcgtc
gagttacttatcaaatatggagctgatgtctacgcttttagcaaatttgataagtctgcc
tttgacatagcaatggagaaaaacaatactgagattttggtcatgcttcaggaagcaatg
cagaatcaggtgaacactaaccacgagagagccaacccagtggctaaccctgtgactgtg
actgctccgttcatcttcacctctggagaggtcattaacctcgctagctttgtctcttca
gccaacaccaaagcaacctcagctcatttagaagaaatggaagaaggaaattctcttgac
tcctcgacccagcaagtggtggggagtggaggccagagggtcatcaccatcgtgactgat
ggagtccctctgggtaacatccaaacatcactccctgctggaggcattggccagccattt
attgtaactatgcaagatggacagcaagttctaactgtgcctgctggtcaggttgcagag
gagacaataattgaagatgaagaagaggaagaagagaaattgccattggtgaagagacca
aggatggcagagatgacaaacagggttgaggaaatgaaggaaggcagtgaaagagagcta
ctgcagcaacagctccaggaggccaaccgaagagcccaggagtacagacaccagctcctc
aagaaagagcaggaggccgagcagtatcggctcaggctggaggctatggctcagcagcag
accaacggagttgaagttgatgtcaccgtagttgaggaagtagctgaagtggatgctgta
gtggtgacagaaggggacgaggtagaaagagcaacacaagtcatgaagtcaggaaggacc
acggagcctcacactaacgtttccatagaaactatttcatcctaa

DBGET integrated database retrieval system