KEGG   Mus musculus (mouse): 213084
Entry
213084            CDS       T01002                                 

Gene name
Cdkl3, AI852479, B230379H01Rik
Definition
(RefSeq) cyclin-dependent kinase-like 3
  KO
K08824  cyclin-dependent kinase-like [EC:2.7.11.22]
Organism
mmu  Mus musculus (mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:mmu01001]
    213084 (Cdkl3)
Enzymes [BR:mmu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.22  cyclin-dependent kinase
     213084 (Cdkl3)
Protein kinases [BR:mmu01001]
 Serine/threonine kinases: CMGC group
  CDKL family
   213084 (Cdkl3)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr Kinase-like RIO1 Kdo FTA2 MdcG APH Pkinase_fungal YrbL-PhoP_reg
Other DBs
NCBI-GeneID: 213084
NCBI-ProteinID: NP_722480
MGI: 2388268
Ensembl: ENSMUSG00000020389
Vega: OTTMUSG00000005618
UniProt: Q8BLF2
Position
11; 11 B1.3
AA seq 595 aa
MEMYETLGKVGEGSYGTVMKCKHKDTGRIVAIKIFYEKPEKSVNKIATREIKFLKQFRHE
NLVNLIEVFRQKKKIHLVFEFIDHTVLDELQHYCHGLESKRLRKYLFQILRAIEYLHNNN
IIHRDIKPENILVSQSGITKLCDFGFARTLAAPGDVYTDYVATRWYRAPELVLKDTSYGK
PVDIWALGCMIIEMATGHPFLPSSSDLDLLHKIVLKVGNLTPHLHNIFSKSPIFAGVVLP
QVQHPKTARKKYPKLNGLLADIVHACLQIDPAERTSSTDLLRHDYFTRDGFIEKFIPELR
AKLLQEAKVNSFIKPKENFKENEPVRDEKKSVFTNTLLYGNPSLYGKEVDRDKRAKELKV
RVIKAKGGKGDVPDQKKPEYEGDHRQQGTADDTQPSSLDKKPSVLELTNPLNPSENSDGV
KEDPHAGGCMIMPPINLTSSNLLAANLSSNLSHPNSRLTERTKKRRTSSQTIGQTLSNSR
QEDTGPTQVQTEKGAFNERTGQNDQISSGNKRKLNFPKCDRKEFHFPELPFTVQAKEMKG
MEVKQIKVLKRESKKTDSSKIPTLLSMDPNQEKQEGGDGDCEGKNLKRNRFFFSR
NT seq 1788 nt   +upstreamnt  +downstreamnt
atggagatgtatgaaacccttggaaaagtgggagagggaagttatggaacggtcatgaaa
tgcaaacataaggacactgggcgaatagtggccattaagattttctatgagaaaccagaa
aaatctgtcaacaaaattgcaacgagagaaataaagtttctaaagcaatttcggcatgaa
aacctggtcaatttgattgaagtttttagacaaaagaagaaaattcatttggtatttgag
tttattgaccacacggtcttagatgagctgcagcactactgtcacggactagagagtaag
cggctgagaaagtacctcttccagatccttcgcgccattgagtacctgcataataataat
attatccatcgagatataaagcctgagaatattttagtctcccagtcaggaattacgaag
ctgtgtgattttgggtttgcgaggacactagcagctcctggagacgtttacacagactac
gtggccacacgctggtacagagctccagagctggtgttgaaagacacctcctacggaaag
ccagtggacatctgggctttgggctgtatgatcattgaaatggccactggccatcccttc
cttcctagcagttccgatttggatttgctccacaagattgttttaaaagtaggcaacctg
accccgcacctgcacaatatcttttccaagagtcccatctttgctggggtggttcttcct
caagttcaacacccaaaaaccgcaagaaagaaataccccaagctcaatggattgctggca
gatatagttcatgcttgtttacaaattgatcctgctgagaggacatcatctactgatctt
ttgcgtcacgattactttactagagatggatttattgagaaattcataccagagctgaga
gctaaattattacaggaagcaaaggttaattcatttataaagccaaaagagaattttaaa
gaaaatgaacctgtgagagatgagaagaaatcagtttttaccaacaccctgctctatgga
aatccatcactttatggcaaggaagtggacagagacaaaagggccaaggagctcaaagtc
agagtcattaaggccaaagggggcaaaggagatgtcccagaccagaagaagccagagtat
gaaggcgaccaccgccagcagggcacagctgatgacacacagccctcatcactggacaag
aagccttctgtcttggaactgacaaaccctctcaatcccagtgagaattctgacggtgtc
aaagaagacccacacgctgggggttgtatgataatgccacctatcaacctgacaagcagt
aatttgttggccgcaaatctcagttcaaacctttcccaccccaattcacggttaactgaa
agaacaaaaaagagacgcacttcttcacaaactattggacagactttgtctaatagcaga
caagaggacacaggtcccacacaagtccaaacagagaaaggtgcatttaatgagcgaaca
ggtcagaatgaccaaatatcgagtgggaacaaaagaaagctgaattttcccaaatgcgac
aggaaagaattccatttccctgaactgccattcacagtgcaggcgaaggagatgaaaggg
atggaagttaaacagataaaagtgctgaagagagaatcaaagaaaacagattcatctaaa
ataccaactttacttagtatggacccaaatcaagaaaaacaagagggtggagatggcgat
tgtgaggggaagaatttgaagaggaacagattttttttttcccgatag

DBGET integrated database retrieval system