KEGG   Mus musculus (mouse): 213119
Entry
213119            CDS       T01002                                 

Gene name
Itga10, A630048L14
Definition
(RefSeq) integrin, alpha 10
  KO
K06586  integrin alpha 10
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04151  PI3K-Akt signaling pathway
mmu04510  Focal adhesion
mmu04512  ECM-receptor interaction
mmu04810  Regulation of actin cytoskeleton
mmu05165  Human papillomavirus infection
mmu05410  Hypertrophic cardiomyopathy
mmu05412  Arrhythmogenic right ventricular cardiomyopathy
mmu05414  Dilated cardiomyopathy
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04151 PI3K-Akt signaling pathway
    213119 (Itga10)
  09133 Signaling molecules and interaction
   04512 ECM-receptor interaction
    213119 (Itga10)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    213119 (Itga10)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    213119 (Itga10)
 09160 Human Diseases
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    213119 (Itga10)
  09166 Cardiovascular disease
   05410 Hypertrophic cardiomyopathy
    213119 (Itga10)
   05412 Arrhythmogenic right ventricular cardiomyopathy
    213119 (Itga10)
   05414 Dilated cardiomyopathy
    213119 (Itga10)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04515 Cell adhesion molecules [BR:mmu04515]
    213119 (Itga10)
Cell adhesion molecules [BR:mmu04515]
 Integrins
  Integrin alpha subunits
   213119 (Itga10)
SSDB
Motif
Pfam: VWA Integrin_alpha2 FG-GAP VWA_2 FG-GAP_2 VCBS
Other DBs
NCBI-GeneID: 213119
NCBI-ProteinID: NP_001289400
MGI: 2153482
Ensembl: ENSMUSG00000090210
Vega: OTTMUSG00000029578
UniProt: E9PXZ3
Position
3; 3 F2.1
AA seq 1166 aa
MESLSIPHLLLPLALLTGLCSSFNLDEHHPRLFTGPPEAEFGYSVLQHVGGGQRWMLVGA
PWDGPSGDRRGDVYRCSIGGFHSAPCTKGHLGDYQLGNSSQPAVNMHLGMSLLETDADGG
FMACAPLWSRACGSSVFSSGICARVDASFRPQGSLAPTAQRCPTYMDVVIVLDGSNSIYP
WSEVQTFLRRLVGRLFIDPEQIQVGLVQYGENPVHEWSLGDFRTKEEVVRAARNLSRREG
RETRTAQAIMVACTEGFSQSRGGRPEAARLLVVVTDGESHDGEELPAALKACEAGRVTRY
GIAVLGHYLRRQRDPSSFLREIRAIASDPDERFFFNVTDEAALTDIVDALGDRIFGLEGS
RGENESSFGLEMSEIGFSIHRLQDGILFGMVGAYDWGGSVLWLEEGRRLFPPQAALEDEF
PPALQNHAAYLGYSVSSMLLPGGRRLFLSGAPRFRHRGKVIAFQLKKDGVVRVAQSLQGD
QIGSYFGSELCPLDTDKDGITNILLVAAPMFLGPQNKETGRVYVYMVGQQNLLMLQGTLQ
PDRSQDSRFGFAMAALPDLNHDGFTDVAVGAPLEDGHRGALYLYHGTQTGIRPHPTQRIA
AVSMPQALRYFGRSVDGRLDLDGDDLVDVAVGAHGAAVLFSSQPIIHLIPTLDVMPPHIS
VVQKDCKRRGQEAACLTAALCFQVVSQTPGRWDRRFYIRFSASLDEWTAGARAVFDGSGQ
RLSPRQLQLSVGNVTCEQLHFHALDTSDYLRPVALTVTFALDNTTKPGPVLAEGSSTTIR
KLIPFSKDCGPDNECVTDLVLQADMDIRGSRKSPFVVQGGRQKVLVSATLENKKENAYNT
SLSLSFSRNLHLASLTPQAKSVKVECAVPSPHTRLCTVGHPVFQTGAKVSFLLEFEFSCT
FLLSQVFVRLTASSSSLEMNETLQDNTAQTSAYIRYEPHLVFSSESTLHRYEVHPYRTLP
MGPGPEFKTTLRVQNLGCHVVSGLVISALLPAVAHGGNYFLSLSQVISGNASCTVQNLTE
PPGFPVHPEELQHASRLNGSNSRCQVVRCHLGLLAKGTEISVRLLRLVHNEFFRRAKFKS
VTVVSTFKLGTEEGSVLLLNEASRSSESHLEVIQTHPTLISLWILVGSVLGGLLLLALLV
FCLWKLGFFTRKKIPKEEESEEKLEQ
NT seq 3501 nt   +upstreamnt  +downstreamnt
atggagtctctctccatccctcacctgctcctgcccctggcgttgctgacaggtctctgc
tcctcctttaatctggatgaacaccacccacgactcttcacagggccaccagaggccgaa
tttggatacagtgtcttacagcatgttgggggtggacagcgatggatgctggtgggtgcc
ccctgggatgggccatcaggtgaccggagaggggatgtttatcgttgctctataggggga
ttccacagtgctccatgtaccaaaggccacctgggtgactatcaacttggaaattcctct
cagcctgctgtgaatatgcacctagggatgtctctactagagacagatgctgatggggga
ttcatggcctgtgcccctctttggtctcgtgcctgcggcagctctgtcttcagttctgga
atatgtgcccgtgtggatgcttcattccggccccagggaagcctggcacccaccgcccaa
cgctgtcccacatacatggatgtcgtcattgttttggatggctccaacagtatctatccc
tggtcagaagttcagactttccttcggaggctggtaggaagactgttcatcgatccggag
cagatacaggtaggactggtacagtacggggagaaccctgtgcatgagtggtccctggga
gacttccgaacaaaggaagaagttgtgagagcagcaaggaacctaagtcggagggaaggg
cgagaaacgagaaccgcccaagcgatcatggtggcatgcacagaagggttcagtcagtcc
cgggggggacgaccagaggccgctaggctgctggtagttgtcactgatggagagtcccat
gatggagaggaacttccagcagcgctaaaggcctgtgaggctggcagagtgacacgttat
gggattgcggtccttggtcactatctccggcgacagagagaccccagctcttttcttcgg
gaaatcagagctattgctagtgatccagatgagcgattcttcttcaatgtcaccgatgaa
gctgcgctgacagacattgtggatgcactgggggaccgaatttttggtcttgaagggtcc
cgtggagaaaatgaaagctcctttgggctagaaatgtctgagattggcttctccatccac
cgactacaggatgggattctctttgggatggtgggggcctatgactgggggggctccgtg
ctatggcttgaagaaggtcgccgccttttcccaccacaagctgccctggaagatgagttc
ccccctgcgttgcagaaccatgcggcctacctgggttactctgtttcctccatgcttctt
cccggtggacgccgcctctttctctcaggggcaccgaggtttagacatcgaggaaaagtt
atcgccttccagctaaagaaagatggggttgtgagggtcgcccagagcctccagggggat
cagattggctcatactttggcagcgagctctgcccgttggatacagataaggacggaata
actaatatcttacttgtggcggctcccatgttcctgggtccccagaacaaggagaccgga
cgcgtttatgtgtacatggtgggccagcaaaatttgctaatgctccaaggaacccttcag
ccagaccgttcccaggattctcggtttggctttgccatggctgctcttcctgatctgaac
catgatggtttcactgatgtagcggtgggggcacccctggaggatggacaccggggagcg
ttgtacctgtatcatggaacccagactggaatcaggccgcatcctacccagaggattgct
gctgtctccatgccacaggccctccgatacttcggccgaagtgtggatggccgcttagat
ctggatggagatgatcttgtagatgttgccgtgggtgcccacggggcagccgttctgttc
agctcccagcccatcatccacctgattccaaccctggatgtgatgcctccccacatcagt
gtggttcagaaggactgtaaaagacgaggccaggaagcagcctgtctgaccgcagccctt
tgcttccaagtagtgtctcaaactcctgggcgttgggatagaagattctacataagattc
tcagcatcactggatgagtggaccgctggggcacgtgcagtattcgatggctctggtcag
cgcctgtcccctcggcagctccagcttagtgttggcaatgtcacttgtgaacagctgcac
ttccatgcactggatacatcggattacctccggccagtggccttgactgtgacttttgct
ttggacaacaccacgaagccagggcctgtgctggcggaaggatcctctacgactatacgg
aagctgatccccttctcaaaggactgtggccctgacaatgaatgtgtcacagacctggtg
cttcaagctgacatggacatcagaggctccaggaagtccccatttgtggttcaaggtgga
cgacagaaagtgctggtgtctgcgaccctggagaacaagaaggagaatgcctacaacact
agcctgagtctcagcttttctagaaacctccacctggccagtcttactcctcaggccaaa
tcagtgaaggtggagtgcgcagtcccttccccccatacccggctctgcaccgtggggcat
ccggtcttccagactggggccaaggtgagcttcctgttagagtttgaatttagctgcacc
ttcctcctgagccaggtctttgtgaggctgactgccagtagcagtagcctagagatgaat
gagacccttcaagataacacagctcagacctctgcctacatccggtacgaacctcacctc
gtgttctccagtgagtccactctgcatcggtatgaggttcacccttataggactctccca
atgggtcctggccctgaattcaagaccactcttagggttcagaatcttggttgccatgtg
gtcagtggtctcgtcatctccgccctccttccagctgtagcccatgggggtaactacttc
ctgtcactatctcaagtcatctctggcaatgcaagctgcacggtgcagaacctgactgag
cccccgggcttccctgtgcacccagaggagcttcagcatgcaagcagactgaatgggagt
aacagtcgatgtcaggtggtaaggtgccaccttggactgctggcaaaggggactgagatc
tctgtcaggctgctgaggctggttcacaatgaattctttcggagggccaagttcaagtct
gtgacagtggtcagcaccttcaagttaggaactgaggagggcagtgtcctactactgaat
gaagcctcccgctcgagtgagagtcacttggaggtgattcagacccacccgaccctcatc
tccctgtggatcctcgttggcagtgtcctgggggggctgctcctgcttgctctccttgtc
ttctgcctgtggaagcttggcttctttacccgtaagaaaatccccaaagaagaagaaagt
gaggagaagttggagcagtga

DBGET integrated database retrieval system