KEGG   Mus musculus (mouse): 213236Help
Entry
213236            CDS       T01002                                 

Gene name
Dnd1, BC034897, RBMS4, Ter
Definition
(RefSeq) DND microRNA-mediated repression inhibitor 1
Organism
mmu  Mus musculus (mouse)
SSDB OrthologParalogGFIT
Motif
Pfam: DND1_DSRM RRM_1
Motif
Other DBs
NCBI-GeneID: 213236
NCBI-ProteinID: NP_775559
MGI: 2447763
Ensembl: ENSMUSG00000044595
Vega: OTTMUSG00000034043
UniProt: Q6VY05
Position
18 B2; 18 19.46 cM
AA seq 352 aa AA seqDB search
MQSKRECEQWCERVNPENKAALEAWVRETGIRLVQVNGQRKYGGPPPGWVGSPPPSGSEV
YIGRLPQDVYEHQLIPLFQRVGRLYEFRLMMTFSGLNRGFAYARYSSRRGAQAAIATLHN
HQLRPSCQLLVCRSTEKCELTVDGLPLSLNRRALLLALQPFGPCLQETLLLPSPGSAPSQ
IALLKFSTHRAAAMAKKALVEGQSRLCGEQVAVEWLKPDLKQHFRQQLAGPSLRFLRPDV
SQLTQTREKLGSQGARAALQLLCQRMKLGSPVFLTKCLGTGPAGWHRFWYQVVIPGHPVP
FSGLIWVVLASDWQDGHEVAKDAVSAQLLEALSEPRTSLWSPGAEAGTMVKQ
NT seq 1059 nt NT seq  +upstreamnt  +downstreamnt
atgcagtccaaacgggagtgcgagcaatggtgtgagagggtgaatccagagaacaaggca
gccctggaggcgtgggtaagggagactggcatccgcctggtgcaggtcaacgggcaaagg
aagtatggagggccacccccaggctgggtgggcagcccgccaccgtcagggtccgaggtg
tatatcggacgacttccgcaggacgtgtacgagcaccagctaatcccactcttccagcgc
gtggggcgcctctatgagttccgcctaatgatgaccttcagtggtttgaaccgcggcttt
gcctatgcgcgctacagctcgcggcgcggtgcccaggccgccattgctacgctgcacaac
caccagctgcggccttcttgccagctcctggtgtgccgaagcaccgagaagtgcgagctg
acggtggacgggctgcctcttagcttaaaccgccgagcgttactgctcgccctgcaaccg
ttcggtccctgcctccaggagacactgctgctacccagccctgggtctgcgccctctcag
attgcgctgctcaagttcagtacgcaccgagctgctgctatggccaaaaaggccctggta
gaaggtcagtcacgcctctgtggagagcaggtggctgtggagtggctcaagccagaccta
aagcagcacttccgccagcagcttgcaggtccctcactgcggttcctcaggccagatgtc
agccaactaacccagaccagggagaagctggggtcccaaggggctcgggctgccctgcaa
ctgctgtgtcaacggatgaagctaggcagcccagtgttcctgaccaagtgtttaggaaca
gggcctgctggctggcatcgcttttggtaccaggtggtgatccctgggcatccagtgcct
ttcagtggcctcatttgggttgtgttggcctctgattggcaggatgggcatgaggtggcc
aaggatgctgtgtccgcacagctgctggaggcactgagtgaacctaggaccagcttgtgg
tctcctggggctgaagcaggtactatggttaagcagtga

DBGET integrated database retrieval system