KEGG   Mus musculus (mouse): 213272
Entry
213272            CDS       T01002                                 

Symbol
Txndc2, AU021712, Sptrx-1, Sptrx1, Trx4
Name
(RefSeq) thioredoxin domain containing 2 (spermatozoa)
Organism
mmu  Mus musculus (mouse)
SSDB
Motif
Pfam: Thioredoxin Glutenin_hmw Thioredoxin_2 Thioredoxin_8 Thioredoxin_7
Other DBs
NCBI-GeneID: 213272
NCBI-ProteinID: NP_705739
MGI: 2389312
Ensembl: ENSMUSG00000050612
UniProt: Q6P902 A0A3B2W416
Position
17:complement(65944500..65955871)
AA seq 543 aa
MFKKDKQKNKDKGLDMNSVQAGAPEESDMTLNNGGKANERGSNENPLQALSKNEAFLVPE
FLDTAQSKEKAIASKVSNTLHMSTEESEFPQQVSSTPMFSENTVHPRHEVSPKPSSKNTQ
LKQENISKSSGYSKQTNYSNTPKSLAKTTHPKQGSTLKPATNSTHYREDDIPKSSEDIIQ
PKKGDRPKSSEDIIQSKKEDRPKSSEDIIQSKKEDRPKSSEDIIQSKKEDRPKSSEDIIQ
SKKEDRPKSSEDIIQPKKEDRPKSSEDSVPSKKGDRPKSSEDSVQPKKEDRPKSSEDSVQ
SKEGEVHKPLKDSIQSKETKVPKSPQDSIQSKEDKTHRPLKDSVQSKESEEPKSSHESIQ
SKEDKIHKPLKDSIPSKEGDIPKSPEDTIQSQEEITASEEDTIQSQEGNTIKSSEEDVQL
SESKLLGLGAEIETLEEGLVRVIKDKEEFEEVLKDAGEKLVAVDFSAAWCGPCRMMKPLF
HSLSLKHEDVIFLEVDTEDCEQLVQDCEIFHLPTFQFYKNEEKVGEFSGALVGKLERSIS
ELK
NT seq 1632 nt   +upstreamnt  +downstreamnt
atgtttaagaaggacaaacaaaagaataaggacaaggggctggacatgaacagtgttcaa
gcaggagctcctgaagagtcggacatgacactcaacaacggaggaaaagcaaatgaaagg
ggcagcaacgaaaatccattacaggctttatccaaaaatgaggcttttctggtcccagag
ttcttggatacagcccagtccaaagagaaggccattgcttccaaggtcagcaatacactt
catatgtccacagaagagtctgagttcccgcagcaagttagtagcacccccatgttttca
gagaataccgtccatcccagacatgaagttagccccaagccttcatcaaaaaacactcag
ctgaaacaggaaaatatttctaaatcctcgggctactccaagcagaccaactatagcaac
actcccaagtccttggcaaaaaccacccatcccaaacaggggagcaccctcaagcctgca
acgaacagcacccattacagggaggatgacattcccaagtcctcagaagacatcatccaa
cccaagaaaggggacaggcccaagtcctcagaagacatcatccaatccaagaaagaggac
aggcccaagtcctcagaagacatcatccaatccaagaaagaggacaggcccaagtcctca
gaagacatcatccaatccaagaaagaggacaggcccaagtcctcagaagacatcatccaa
tccaagaaagaggacaggcccaagtcctcagaagacatcatccaacccaagaaagaggac
aggcccaagtcctcagaagacagcgtcccatccaagaaaggggacaggcccaagtcctca
gaagacagcgtccaacccaagaaagaggacaggcccaagtcctcagaagacagcgtccaa
tccaaggaaggtgaagtccacaagcccttaaaagacagcattcagtccaaggagactaaa
gtccctaagtccccacaggactcaatccagtccaaagaggataaaacccacaggccctta
aaggacagcgttcagtcaaaggagagtgaagaacctaagtcctcccatgaatccatccag
tccaaggaggataaaatccataagcctttaaaagatagcatcccatctaaggagggagat
attcccaagtccccagaagataccatccagtcccaggaagaaatcaccgcgtccgaagaa
gacaccatccagtcccaggaaggtaacactatcaagtcttcagaagaagatgtgcagctc
tcagagagcaaactcttaggccttggagcagaaatagagaccctggaggaaggcttggtg
agagtgatcaaagacaaggaggaatttgaggaggtgctcaaagacgctggagagaagctg
gtggctgtggatttctcagccgcttggtgtggcccctgcagaatgatgaagccactcttc
cattccctgtctttgaagcacgaggatgtgatattcttggaggtggacactgaggattgt
gagcagctggtgcaagactgtgagatctttcacctcccgactttccagttttataaaaac
gaagaaaaggtgggtgaattttctggtgcccttgtgggaaaactcgaaagaagcatttca
gaattaaagtaa

DBGET integrated database retrieval system