KEGG   Mus musculus (mouse): 21336Help
Entry
21336             CDS       T01002                                 

Gene name
Tacr1, Nk1r, Spr, Tac1r
Definition
(RefSeq) tachykinin receptor 1
  KO
K04222  tachykinin receptor 1
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04020  Calcium signaling pathway
mmu04080  Neuroactive ligand-receptor interaction
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04020 Calcium signaling pathway
    21336 (Tacr1)
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    21336 (Tacr1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:mmu04030]
    21336 (Tacr1)
G protein-coupled receptors [BR:mmu04030]
 Rhodopsin family
  Peptide
   Tachykinin
    21336 (Tacr1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 7tm_1 7TM_GPCR_Srsx 7tm_4
Motif
Other DBs
NCBI-GeneID: 21336
NCBI-ProteinID: NP_033339
MGI: 98475
Ensembl: ENSMUSG00000030043
Vega: OTTMUSG00000057802
UniProt: P30548
Position
6; 6 C3
AA seq 407 aa AA seqDB search
MDNVLPVDSDLFPNTSTNTSESNQFVQPTWQIVLWAAAYTVIVVTSVVGNVVVIWIILAH
KRMRTVTNYFLVNLAFAEACMAAFNTVVNFTYAVHNVWYYGLFYCKFHNFFPIAALFASI
YSMTAVAFDRYMAIIHPLQPRLSATATKVVIFVIWVLALLLAFPQGYYSTTETMPSRVVC
MIEWPEHPNRTYEKAYHICVTVLIYFLPLLVIGYAYTVVGITLWASEIPGDSSDRYHEQV
SAKRKVVKMMIVVVCTFAICWLPFHIFFLLPYINPDLYLKKFIQQVYLASMWLAMSSTMY
NPIIYCCLNDRFRLGFKHAFRCCPFISAGDYEGLEMKSTRYLQTQSSVYKVSRLETTIST
VVGAHEDEPEEGPKATPSSLDLTSNGSSRSNSKTMTESSSFYSNMLA
NT seq 1224 nt NT seq  +upstreamnt  +downstreamnt
atggataacgtccttcctgtggactctgatctcttccccaacacctccaccaacacttct
gagtctaaccagtttgtgcaacctacctggcaaattgtcctttgggcagccgcctatacg
gtcatcgtggtgacttccgtggtgggcaacgtagtggtgatatggatcattttggcccac
aagagaatgaggacagtgaccaattatttcctggtgaacctggccttcgctgaggcctgc
atggctgcattcaatacagtggtgaacttcacctacgcagtccacaacgtgtggtactac
ggcctcttttactgcaagtttcacaacttcttccccattgctgctctcttcgccagtatc
tactccatgacagctgtggcctttgacagatacatggccatcatccaccctcttcagccc
cggctgtcggccactgctaccaaagtggtcatctttgtcatctgggtcctggctctcctg
ctggccttcccacagggctactactccaccacagagaccatgcccagcagagtagtgtgc
atgattgagtggccagaacatcccaacaggacttacgagaaagcgtaccacatctgtgtg
actgtgctgatctacttcctgcctctgctggtgattggctatgcatacactgtggtaggg
attacactgtgggccagtgagatccccggtgactcctctgaccgttaccatgagcaagtc
tctgccaagcgcaaggtggtcaaaatgatgatcgtggttgtgtgtaccttcgccatctgc
tggctgcccttccacatcttcttcctcctgccctacatcaacccagatctctaccttaag
aagttcatccagcaggtctacctggccagcatgtggctggccatgagttctaccatgtac
aaccccatcatctactgctgcctcaatgacaggttccgtctgggcttcaagcatgccttt
cgctgctgccctttcatcagtgctggtgattatgaggggctggaaatgaaatccacccga
tacctccagacccagagcagcgtgtacaaggtcagccgcctggagaccaccatctccact
gtggtgggagcccatgaagatgagccagaggaaggtcccaaggccacaccttcatccttg
gatctcacctccaatggctcctctcgaagcaactcgaagaccatgacagaaagctccagc
ttctactctaacatgctggcctaa

DBGET integrated database retrieval system