KEGG   Mus musculus (mouse): 213389
Entry
213389            CDS       T01002                                 

Gene name
Prdm9, BC012016, Dsbc, Dsbc1, G1-419-29, Meise, Meisetz, PRDM9-B, Rc, Rcr1, re, repro7
Definition
(RefSeq) PR domain containing 9
  KO
K20796  [histone H3]-lysine4 N-trimethyltransferase PRDM7/9 [EC:2.1.1.354]
Organism
mmu  Mus musculus (mouse)
Pathway
mmu00310  Lysine degradation
mmu01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00310 Lysine degradation
    213389 (Prdm9)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:mmu03000]
    213389 (Prdm9)
   03036 Chromosome and associated proteins [BR:mmu03036]
    213389 (Prdm9)
Enzymes [BR:mmu01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.354  [histone H3]-lysine4 N-trimethyltransferase
     213389 (Prdm9)
Transcription factors [BR:mmu03000]
 Eukaryotic type
  Zinc finger
   Cys2His2 PRDM
    213389 (Prdm9)
Chromosome and associated proteins [BR:mmu03036]
 Eukaryotic type
  Histone modification proteins
   HMTs (histone methyltransferases)
    HKMTs (histone lysine methyltransferases)
     213389 (Prdm9)
SSDB
Motif
Pfam: SSXRD SET zf_PR_Knuckle
Other DBs
NCBI-GeneID: 213389
NCBI-ProteinID: NP_001348365
MGI: 2384854
Ensembl: ENSMUSG00000051977
Structure
PDB: 
4C1Q

Position
17; 17 A2
AA seq 283 aa
MPFSGESNVKEGSGIENLLNTSGSEHVQKPVSSLEEGNTSGQHSGKKLKLRKKNVEVKMY
RLRERKGLAYEEVSEPQDDDYLYCEKCQNFFIDSCPNHGPPLFVKDSMVDRGHPNHSVLS
LPPGLRISPSGIPEAGLGVWNEASDLPVGLHFGPYEGQITEDEEAANSGYSWLITKGRNC
YEYVDGQDESQANWMRYVNCARDDEEQNLVAFQYHRKIFYRTCRVIRPGCELLVWYGDEY
GQELGIKWGSKMKKGFTAGRGGHYYDSLKKKEKREFSLRIFIF
NT seq 852 nt   +upstreamnt  +downstreamnt
atgccatttagtggtgaatctaatgtgaaggaagggtctggaatagaaaatttgctgaat
acaagtggctcagaacacgtccagaaaccagtgtcctcccttgaagaaggaaatacctct
ggacagcactctgggaaaaaactgaaacttaggaaaaagaacgttgaagtgaaaatgtac
aggctgcgagagagaaagggccttgcctatgaggaggtcagcgagcctcaggatgatgac
tatctctattgtgagaagtgccagaatttcttcatcgacagttgtcccaaccatgggcct
cctttatttgtaaaagacagtatggtggacagggggcatcccaaccactcagtcctcagt
ctgccccctgggctaagaattagtccatcgggcatccctgaagctggacttggagtatgg
aatgaagcatctgatctaccagtcggtctgcactttggcccctatgagggtcagatcaca
gaggatgaagaggcagccaacagtggttactcctggctgattaccaagggaagaaactgc
tatgagtatgtggatggacaggacgagtcccaagccaactggatgaggtatgtgaactgt
gcccgggatgatgaagagcagaacctggtagcctttcaatatcacaggaaaatcttctat
cgaacctgccgggttatcagaccaggttgtgagcttctggtctggtatggggatgagtac
ggccaggaactgggcattaagtggggaagcaagatgaagaaaggattcacagcaggaaga
ggtgggcactattatgattccttaaaaaagaaagagaagagggaattctccttgagaatt
ttcattttctaa

DBGET integrated database retrieval system