KEGG   Mus musculus (house mouse): 213393
Entry
213393            CDS       T01002                                 
Symbol
Depp1, 8430408G22Rik, Depp, Fseg
Name
(RefSeq) DEPP1 autophagy regulator
Organism
mmu  Mus musculus (house mouse)
SSDB
Motif
Pfam: DEPP
Other DBs
NCBI-GeneID: 213393
NCBI-ProteinID: NP_001160052
MGI: 1918730
Ensembl: ENSMUSG00000048489
UniProt: Q8K2F3
Position
6:116627645..116629808
AA seq 205 aa
MRSRLLLPVPHLPTIREMSEELSHGAAGQEPPASPSLDDYVRCICQLAQPTSVLDKVTAQ
SRPNRPSRPAWTREKRRQAESPGDSSLCVSSLQPTLPSPGTDNPLDWLFGKSQGEQADGR
GRPNRTGSSDPWDVPRQMGKDTGRLCEARVPEHSLGRKPGPRHQTSDLKSWTSRKSCRAL
ASVSSSRPSSILGTLYLHLPVIHEL
NT seq 618 nt   +upstreamnt  +downstreamnt
atgaggtcccggcttctgctgcccgtgccccatttgccaacgattcgggaaatgtcagaa
gagctgtcacatggggcagctgggcaggaacccccagcgtcccccagcctggatgactac
gtcaggtgtatctgtcagctggcacagcccacctcagtgctggacaaggtcacagcccag
agccgtcccaacagaccctcccggccagcctggactcgagagaagaggcgccaggccgag
tctccaggagacagctctctttgcgtcagcagcctgcagcccacactgccctctcccggc
actgacaaccctctggactggctctttgggaagtcacagggagagcaggcagatgggaga
ggtcgacccaacaggactggttcttcagatccctgggatgtgcccagacagatgggcaag
gacacggggagactctgtgaggccagggtacctgagcactctctgggaagaaaaccaggg
cccaggcaccagacctccgacctgaaaagctggacttctagaaagtcctgccgggcctta
gcgtccgtctccagctctcgccccagcagtatcctaggtactctctatttgcacctccca
gtgatccatgaactctaa

DBGET integrated database retrieval system