KEGG   Mus musculus (mouse): 21340
Entry
21340             CDS       T01002                                 

Symbol
Taf1b, 4930408G01Rik, A230108M10Rik, TAFI68, Tafi86, p63
Name
(RefSeq) TATA-box binding protein associated factor, RNA polymerase I, B
  KO
K15213  TATA box-binding protein-associated factor RNA polymerase I subunit B
Organism
mmu  Mus musculus (mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03021 Transcription machinery [BR:mmu03021]
    21340 (Taf1b)
Transcription machinery [BR:mmu03021]
 Eukaryotic type
  RNA polymerase I system
   Basal transcription factors
    SL1/TIF-1B
     21340 (Taf1b)
SSDB
Motif
Pfam: zf-RRN7 NOB1_Zn_bind
Other DBs
NCBI-GeneID: 21340
NCBI-ProteinID: NP_065639
MGI: 109577
Ensembl: ENSMUSG00000059669
UniProt: P97358
Position
12; 12 A1.3
AA seq 586 aa
MDVEEVKAFRDRCSQCAAVSWGLTDEGKYYCTSCHNVTDRSEEVVSAADIPNTKINSINR
GLRQRSKHEKGWDWYVCEGFQCILYHQAKALETLGVSPELKNEVLHNFWKRYLQKSKQAY
CKNPVRTSGRKAKVLEDSVQSSDLGSDLELLSDTTCPLESEAEFQSDPQIPKPFPVTKGS
PKSASVCSGSVDGVEYSERKEKGLVKMTVPRTLALCSLSLLWQRETITVSDLLRFVEEDH
IPYINAFKLFPEEMKVYGRDKGIFAIESWPDYEDIYKNMIELAIFLDLPRFPDITEDCYL
HPNTLCMKYLLEVNLPDEMHTLTCQVVKLTGIGEVDFLTFDPIAKTKRTVKYDVQAMAVI
VVVLKLLFLLDDKLEWSYSDLAEAYNEQHREDTPQFDFRKWYQVMKKTFDEKRRKWEEAR
ARYAWKTKRPLYRSHIDKSVAYKRRKMVENLQKQFSALVGSSPVVEKQAPSSFQFNWTEE
GTDSPCFHGHSLQGLLIMKGQSMITKNSLYWLSTQKFCKSYCKHVTTYEESNFSLSYQFI
LNIFSFLLRIKTSALHEEVSLLEKKLFEKKYNESKKSSGSKKGRRH
NT seq 1761 nt   +upstreamnt  +downstreamnt
atggatgtggaggaggtgaaagcgttcagagaccgctgttctcagtgtgctgctgtctcc
tggggccttaccgatgaaggcaaatattactgtacttcctgccacaatgtcacagatcga
tctgaggaagtggtgagcgctgcagatatccccaacaccaagatcaactccatcaacagg
gggctgagacagagaagcaagcatgagaaaggctgggattggtatgtgtgtgaaggtttc
cagtgcatactttatcaccaagcaaaagccctggagaccctcggagtaagcccagaacta
aagaatgaagtcttacacaatttttggaagcgctaccttcagaagagcaaacaggcctat
tgtaaaaacccagttcgtacaagtggaaggaaagccaaggtattagaagacagtgtgcag
tcctcggacttgggcagtgatcttgagctgctaagtgataccacatgcccccttgaaagt
gaagcagagttccaatctgaccctcagattccaaagcctttccctgtcaccaaaggatcc
ccaaagtcagcgtctgtctgctctggctctgttgatggagtggagtactccgagcggaag
gagaaggggcttgtgaagatgacggtgcccaggacacttgctctctgctctctctccttg
ctctggcagagggaaacaattacagtttcagaccttttgaggtttgttgaagaggatcat
attccgtacataaatgcttttaagctttttccagaagagatgaaagtgtatggtcgtgac
aaaggcatctttgctatagagtcttggcctgactatgaagacatctataaaaacatgatt
gaacttgccatatttttagatttgcctcgtttcccagacataacggaagactgctacctc
catcccaacaccttgtgtatgaaatacttactggaggtcaatctccctgatgaaatgcac
actttaacctgtcaagtagtaaagttgactggaattggggaagtggattttctgacgttt
gatcctatagctaaaacgaaaaggacagttaaatatgatgtgcaggctatggctgtcatt
gtggttgtgttgaagctgctgtttttgctggatgacaagctggaatggtcttactcagat
cttgctgaagcgtacaacgaacaacacagagaagacacgccccagtttgatttcagaaaa
tggtaccaagttatgaagaaaacttttgatgagaaaagacgaaaatgggaagaagcgagg
gccaggtatgcttggaaaaccaaaaggccactctaccgttcacacatcgataagtccgtc
gcatataagagaagaaaaatggtggagaatcttcaaaaacaatttagtgccctggttggt
tcatcacccgtggttgaaaagcaggccccttcaagttttcagttcaactggactgaagaa
ggcactgatagcccttgtttccatggacacagcctccagggactcctgataatgaaaggc
cagtccatgataaccaagaactccctgtattggctcagtacccagaagttctgcaaaagc
tattgtaaacatgtgacaacttacgaagaatcaaatttttctttgagttaccagtttata
ctaaacatcttctccttcttactgagaataaagacctctgctctccatgaagaagtgagc
ttacttgaaaagaaactttttgaaaaaaaatacaacgaatcaaaaaagagctcaggatcc
aagaaaggaagaagacactga

DBGET integrated database retrieval system