KEGG   Mus musculus (mouse): 213449Help
Entry
213449            CDS       T01002                                 

Gene name
Tent5d, Fam46d, Gm377
Definition
(RefSeq) terminal nucleotidyltransferase 5D
  KO
K23035  terminal nucleotidyltransferase 5D [EC:2.7.7.19]
Organism
mmu  Mus musculus (mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:mmu03019]
    213449 (Tent5d)
Enzymes [BR:mmu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.19  polynucleotide adenylyltransferase
     213449 (Tent5d)
Messenger RNA biogenesis [BR:mmu03019]
 Eukaryotic type
  mRNA processing factors
   Other processing factors
    213449 (Tent5d)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: NTP_transf_7
Motif
Other DBs
NCBI-GeneID: 213449
NCBI-ProteinID: NP_001156576
MGI: 2685223
Ensembl: ENSMUSG00000073007
Vega: OTTMUSG00000018254
UniProt: B1ATX6
Position
X; X D
AA seq 390 aa AA seqDB search
MSEIRFSNLTWDHIVTLDRVLHEVIPIHGRGNFPTLEVKPKDIIHIVKDQLIKQGIVVKD
TRLNGSTASYILASHNGISYKDLDIIFGVDIPSDEEFHVVKDAVLSCLFDFLPKGVKKEK
ITLKTMKEAYVQKMVKICNNHDRWSLISLSNNNGKNVELKFVNSLRRQFEFSVDSFQILL
DSMLDFYSVPNAKLTKESCPVVVAESMYGDFQEAMIHLKYKLISTRKPEEIRGGGLLKYS
NLLVRDFKPACQTEIKTLERYMCSRFFIDFPDVAEQQKKIESYLHNHFIGEAKNKYDYLM
TLHGVVNQSTVCLMGYERRQTLNMITLLALKVLGEQNILPSTDNVTCFYQPAPYLVLEGG
YPSYYVASGLPLVYFQPCHTVQFPVQNGMM
NT seq 1173 nt NT seq  +upstreamnt  +downstreamnt
atgtcggagatcagattcagcaatctcacttgggatcacatcgtaacactggatcgtgtg
ttacatgaagtgatcccaattcatggaaggggcaattttcccacgctggaggtaaaacca
aaagatattattcatattgtgaaagatcaactcataaaacagggcattgttgttaaagat
acaagattgaatggctcaacagcaagttacatactcgcaagccataatggaatcagctat
aaagatttggatattatttttggtgttgatataccaagtgatgaagaatttcatgtagtt
aaggatgcagttttaagctgtctatttgacttcttgccaaaaggtgttaaaaaagaaaag
attaccctaaaaaccatgaaagaagcatatgtgcagaaaatggtaaaaatttgcaataac
catgatcgctggagtctcatctccctttcaaataacaacgggaagaacgtagaactaaaa
tttgtgaattcactcagacgacaatttgaatttagtgtagattcttttcaaattcttttg
gattccatgttagatttctatagtgtcccaaatgccaagctaactaaagaatcctgtcct
gttgtggtggctgaaagtatgtatggggactttcaagaagcaatgatacatttgaaatat
aagctaatatctaccagaaaacctgaagagatcagaggtggtggccttttgaagtatagc
aatttgttggttcgtgacttcaaaccagcttgtcaaacagaaattaagactctggaacgt
tatatgtgttctagatttttcattgattttcctgatgtagcagaacagcaaaagaaaatt
gaatcgtacctccacaaccatttcattggtgaagcaaagaacaagtatgactaccttatg
accttgcatggagttgtaaaccaaagcaccgtctgcctcatgggatatgaaagaaggcag
acccttaacatgatcacccttttggctttgaaagtacttggagaacagaatattttaccc
agtacagacaacgtaacttgcttttaccaacctgctccatacctagttcttgagggaggg
taccccagttattatgtagcatctgggctaccactggtttatttccagccatgtcataca
gtgcagttccctgtgcaaaatggtatgatgtaa

DBGET integrated database retrieval system