KEGG   Mus musculus (house mouse): 21346
Entry
21346             CDS       T01002                                 
Symbol
Tagln2, 2700094C18Rik, SM22beta, Sm22B, Sm22a
Name
(RefSeq) transgelin 2
  KO
K20526  transgelin
Organism
mmu  Mus musculus (house mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:mmu04131]
    21346 (Tagln2)
Membrane trafficking [BR:mmu04131]
 Others
  Actin-binding proteins
   Others
    21346 (Tagln2)
SSDB
Motif
Pfam: CH Calponin CDC24 CAMSAP_CH
Other DBs
NCBI-GeneID: 21346
NCBI-ProteinID: NP_848713
MGI: 1312985
Ensembl: ENSMUSG00000026547
UniProt: Q9WVA4
Position
1:172327813..172334942
AA seq 199 aa
MANRGPSYGLSREVQQKIEKQYDADLEQILIQWITTQCREDVGQPQPGRENFQKWLKDGT
VLCKLINSLYPEGQAPVKKIQASSMAFKQMEQISQFLQAAERYGINTTDIFQTVDLWEGK
NMACVQRTLMNLGGLAVARDDGLFSGDPNWFPKKSKENPRNFSDNQLQEGKNVIGLQMGT
NRGASQAGMTGYGMPRQIL
NT seq 600 nt   +upstreamnt  +downstreamnt
atggccaacaggggaccttcctacggcctgagccgagaggtgcagcagaagattgagaag
cagtacgacgcggatctggagcagatcctcatccagtggatcaccactcagtgccgtgag
gacgtgggccagccccagcctggccgtgagaacttccagaagtggctcaaggacggcacg
gttctgtgcaagcttattaattcactgtatcctgaggggcaggccccagtaaagaagatc
caggcctcttcgatggccttcaagcagatggagcagatctcccagttcctgcaggcagcc
gagcgctatggcattaacaccacggacatcttccagactgtggatctctgggaaggaaag
aacatggcttgtgtgcagcggacactaatgaacctgggtgggctggcagtagccagggac
gatgggctcttctctggggatcccaactggtttcctaagaaatccaaggagaaccctcgg
aacttctcggacaaccagttgcaagagggcaagaacgtgattgggttgcagatgggcacc
aaccgtggagcatctcaggccggcatgaccggctatgggatgccacggcagatcctctga

DBGET integrated database retrieval system