KEGG   Mus musculus (mouse): 21349
Entry
21349             CDS       T01002                                 

Gene name
Tal1, Hpt, SCL/tal-1, Scl, bHLHa17, tal-1
Definition
(RefSeq) T cell acute lymphocytic leukemia 1
  KO
K09068  T-cell acute lymphocytic leukemia protein
Organism
mmu  Mus musculus (mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:mmu03000]
    21349 (Tal1)
Transcription factors [BR:mmu03000]
 Eukaryotic type
  Basic helix-loop-helix (bHLH)
   Tal/Twist/Atonal/Hen, Lymphoid factors
    21349 (Tal1)
SSDB
Motif
Pfam: HLH COE1_HLH
Other DBs
NCBI-GeneID: 21349
NCBI-ProteinID: NP_001274317
MGI: 98480
Ensembl: ENSMUSG00000028717
Vega: OTTMUSG00000008586
UniProt: P22091 Q3TZH7
Position
4 D1; 4 52.73 cM
AA seq 329 aa
MTERPPSEAARSDPQLEGQDAAEARMAPPHLVLLNGVAKETSRAAPAEPPVIELGARSGA
GGGPASGGGAARDLKGRDAVAAEARLRVPTTELCRPPGPAPAPAPASAPAELPGDGRMVQ
LSPPALAAPAGPGRALLYSLSQPLASLGSGFFGEPDAFPMFTNNNRVKRRPSPYEMEISD
GPHTKVVRRIFTNSRERWRQQNVNGAFAELRKLIPTHPPDKKLSKNEILRLAMKYINFLA
KLLNDQEEEGTQRAKPGKDPVVGAGGGGAGGGIPPEDLLQDVLSPNSSCGSSLDGAASPD
SYTEEPTPKHTSRSLHPALLPAADGAGPR
NT seq 990 nt   +upstreamnt  +downstreamnt
atgacggagcggccgccgagcgaggcggcacgcagtgacccgcaactagagggacaggac
gcggccgaggcccgcatggcccccccgcacctagtcctgctcaacggcgtcgccaaggag
acgagccgcgcagccccggctgagccccccgtcatcgagctaggagcgcgcagcggcgcg
gggggcggccctgccagtgggggcggtgccgcgagggacttaaagggccgcgacgcagta
gcagccgaagctcgccttcgggtgcccaccaccgagctgtgcagacctcccggacccgcc
ccggcgcccgcgcccgcctcggctcctgcagagctgcctggagacggccgcatggtgcag
ctgagcccgcccgcgctggcagcccctgccggccccggccgagcgctgctctatagcctt
agccagccgctcgcctcactaggcagtgggttctttggggaaccggatgccttccccatg
ttcaccaacaacaaccgggtgaagaggaggccctccccatatgagatggagatttctgat
ggtcctcacaccaaagtagtgcggcgcatcttcaccaacagccgggaacgatggcggcag
cagaatgtgaatggggcatttgctgagctcagaaagctgatccccacccacccaccagac
aagaaactaagcaagaatgagatcctccgccttgccatgaagtacatcaatttcctggcc
aagttactcaatgaccaggaggaggaaggcacccagcgtgccaagcctggcaaggacccc
gtggtgggagctggtgggggtggggcagggggtggcatcccccctgaagaccttctacag
gacgtgctttcccccaactccagctgtggcagctctctggatggggcagccagcccggac
agttacacagaggagccaacacccaagcacacttcccgcagcctccatcctgccctgctg
cctgccgctgatggggctggcccccggtga

DBGET integrated database retrieval system