KEGG   Mus musculus (house mouse): 213498
Entry
213498            CDS       T01002                                 
Symbol
Arhgef11, PDZ-RhoGEF, Prg, RhoGEF, mKIAA0380
Name
(RefSeq) Rho guanine nucleotide exchange factor (GEF) 11
  KO
K12331  Rho guanine nucleotide exchange factor 11
Organism
mmu  Mus musculus (house mouse)
Pathway
mmu04270  Vascular smooth muscle contraction
mmu04928  Parathyroid hormone synthesis, secretion and action
mmu05163  Human cytomegalovirus infection
mmu05200  Pathways in cancer
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09150 Organismal Systems
  09152 Endocrine system
   04928 Parathyroid hormone synthesis, secretion and action
    213498 (Arhgef11)
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    213498 (Arhgef11)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    213498 (Arhgef11)
  09172 Infectious disease: viral
   05163 Human cytomegalovirus infection
    213498 (Arhgef11)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:mmu04131]
    213498 (Arhgef11)
Membrane trafficking [BR:mmu04131]
 Others
  Rho GTPase associated proteins
   Rho guanine nucleotide exchange factors (GEFs)
    213498 (Arhgef11)
SSDB
Motif
Pfam: RGS-like PH_16 RhoGEF PDZ PDZ_6 RGS PDZ_2 Peptidase_M50 PH_13
Other DBs
NCBI-GeneID: 213498
NCBI-ProteinID: NP_001003912
MGI: 2441869
Ensembl: ENSMUSG00000041977
UniProt: Q68FM7
Position
3:87524855..87645346
AA seq 1552 aa
MSIRLPHSIDRLSSLSSLGDSTPERTSPSHHRQPSDTSETTGLVQRCVIIQKDQHGFGFT
VSGDRIVLVQSVRPGGAAMRAGVKEGDRIIKVNGTMVTNSSHLEVVKLIKSGAYVALTLL
GSSPSSIGVSGLQQNPSLSGGPRVNPMIPPPPPPPPLPPPQHITGPKPLQDPEVQKHATQ
ILRNMLRQEEKELQRICEVYSRNPASLLEEQIEGARRRVTQLQLKIQQETGGLVDVLPLC
GETSQRTCEGRLSVDSQEADSGLDSGTERFPSISESLVNRNSVLSDPGLDSPQTSPVILA
RVGQHHRRQGSDAAVHPLNHQGIDQSPKPLIIGPEEDYDPGYFNNESDIIFQDLEKLKSH
PAYLVVFLRYIFSQADPGPLLFYLCSEVYQQTNPKDSRNLGKDIWNIFLEKNAPLRVKIP
EMLQAEIDLRLRNSEDPRSALYEAQEAVMPEIQEQINDYRSKRTLGLGSLYGENDLLDLD
GDPLRERQMAEKQLAALGDILSKYEEDRSAPMDFAVNTYMSHTGIRLRESRPSSTAEKTQ
SAPDKDKWLPFFPKTKKSSNSKKEKDALEDKKRNPILRYIGKPKSSSQSIKPGNVRNIIQ
HFENSHQYDVPEPGTQRLSTGSFPEDLLESDSSRSEIRLGRSESLKGREEMKRSRKAENV
PRSRSDVDMDAAAEATRLHQSASSSASSLSTRSLENPTPPFTPKMGRRSIESPNLGFCTD
VILPHLLEDDLGQLSDLEPEPEVQNWQHTVGKDVVANLTQREIDRQEVINELFVTEASHL
RTLRVLDLIFYQRMKKENLMPREELSRLFPNLPELIEIHNSWCEAMKKLREEGPIIRDIS
DLMLARFDGPAREELQQVAAQFCSYQSVALELIRTKQRKESRFQLFMQEAESHPQCRRLQ
LRDLIISEMQRLTKYPLLLENIIKHTAGGTSEYEKLCRARDQCREILKFVNEAVKQTENR
HRLEGYQKRLDATALERASNPLAAEFKSLDLTTRKMIHEGPLTWRISKDKTLDLQVLLLE
DLVVLLQRQEEKLLLKCHSKTAVGSSDSKQTFSPVLKLNAVLIRSVATDKRAFFIICTSE
LGPPQIYELVALTSSDKNIWMELLEEAVQNATKHPGDAPVLNHPSPPGSQEPAYQGSTSS
RVEVNDSEVYPTEREPKKPSEGPGPEQRGQDKQLLAQEGPEQEEDAEELRALPCPPPSLD
GENRGIRTRDPVLLALTGPLLMEGLADAALEDVENLRHLILWSLLPGHTVKTQAAGEPED
DLTPTPSVVSITSHPWDPGSPGQAPAISDNTQFPRPEGSQPEGEDVALCSLAHLPPRTRN
SGIWDSPELDRNPAEEASSSEPAGSYKVVRKVSLLPGGGVGAAKVAGSNVTPALPESGQS
ESELSEVEGGAQATGNCFYVSMPAEPLDSSTEPPGTPPSLSQCHSLPAWPTEPPQHRGVT
GGQRSSLVLRDMGVIFHTIEQLTVKLHRLKDMELAHRELLNSLGGESSGGTTPVGSFHTE
AARWTDYSLSPPAKEALTSDPQNNQEQGSYPEEGSDTPLEDSATDTASSPGP
NT seq 4659 nt   +upstreamnt  +downstreamnt
atgagcatacggttgccccatagtatagacaggttaagtagcctgtcttctctgggagat
tctacacctgaacgcacatccccttctcaccaccgccagccctctgacacctctgagaca
acaggtcttgttcagcgctgtgtcatcatccaaaaggaccagcatggctttggcttcaca
gttagtggagatcgcattgtgctggtgcagtctgtgcgccctggaggcgcagccatgaga
gctggtgtgaaagagggtgaccggatcatcaaagtaaacggcaccatggtgaccaatagc
tcacacctggaggtagtgaagcttatcaaatctggcgcctatgttgcgcttaccctcctg
ggctcttctccttcctccatcggtgtctctgggctccagcagaacccttctctgtcagga
gggcccagagttaaccccatgattcctccaccacctcctcctccacccttgccacctcca
caacacattactggacctaaacctctacaggatcctgaagtccaaaagcacgccactcaa
atcctcaggaatatgctaaggcaggaggagaaggagttacagcgtatctgtgaggtgtat
agtcggaaccccgccagcctgctagaagagcaaatcgaaggtgcccggcggcgagtcact
caattacagctgaagatccagcaggagactggtggcttagtggatgtacttccactctgt
ggtgagaccagccagagaacatgtgaaggccgcctctctgtggactcccaggaggcagac
agtggcttggactcagggacagaacgctttccctccatcagtgagtcattggtgaatcgg
aactcagtattgtcagatcctggactagacagcccacaaacctcccctgtaatcctggcc
agggtgggccagcaccacaggcgacagggctcagatgcagcggtgcaccccctcaaccac
cagggtatagatcaaagcccaaagcctctgattattggcccagaggaagattatgaccca
ggctatttcaacaatgagagtgacatcatctttcaagatcttgaaaaactgaagtcacat
ccagcttacttggtagtatttctacgttacatcttctctcaggcagaccccggccccctg
cttttttatttgtgttcagaagtttatcagcagacaaatcccaaagattcccgaaatctg
gggaaagacatctggaatattttcctagagaaaaatgcgcctctcagagtgaagatccct
gagatgttgcaggctgagatcgacctacgcctgcgaaacagtgaggaccctcgcagcgcg
ctttatgaagctcaggaggcagtcatgccggagatccaggagcagatcaatgactataga
tcaaagcgcactctggggctgggcagcctctatggtgaaaatgacctactagacctggat
ggggaccctcttcgagagcgccaaatggctgagaagcaactggctgcccttggagatatc
ttgtccaaatatgaggaagatcggagtgctcccatggacttcgctgttaatacctacatg
agccacactgggatccgtcttcgggagtctcgaccttccagcacagcagaaaagacccag
tctgcccccgacaaggacaagtggctgcccttcttccctaagaccaagaagagcagcaat
tccaagaaagaaaaggacgccttggaggacaagaagcgaaaccccatcctcagatacatt
gggaagcccaagagctcttctcagagcattaagccaggcaatgtgaggaacatcattcag
cactttgagaacagccatcagtatgatgtcccagagccggggacacagcgactctcaaca
ggaagctttcctgaggacctgctggagagtgacagttcacgctcagagattcgccttggc
cgctctgaaagcctcaagggccgggaggagatgaagcgatcccggaaggcagagaatgtg
ccccggtctcgaagtgatgttgacatggatgctgctgctgaggctactcgccttcatcag
tcagcctcatcctctgcctccagcctctccaccaggtctcttgagaacccaacccctccc
ttcacccccaaaatgggccgcaggagcattgagtcccccaatctggggttctgtacagat
gtcatccttccccacctccttgaggatgatctgggccaactgtctgacctggagccagag
ccagaagtccaaaactggcagcatacagtgggcaaggatgtggtggcaaacttgacacag
agggaaattgaccggcaagaggtcatcaatgagctctttgtgacagaagcatcccacctg
cgcacgctacgagtcctggacctcatcttctaccagcgcatgaagaaggagaacctaatg
ccacgggaagagctgtcaaggctcttccctaatctgcctgaactcatagagatccacaat
tcctggtgtgaagccatgaagaagctccgggaggagggccccattatcagagacatcagt
gacctcatgctggctcggtttgatggtcctgcccgagaagagctccagcaagtagctgca
caattctgttcctatcagtcagtagccctggagctaatcaggactaaacaacgcaaggag
agtcgattccagctcttcatgcaggaagccgagagccacccccagtgtcggcgtctgcag
cttcgtgacctgatcatctctgagatgcagcggctcactaagtacccactgctgctagag
aacatcatcaagcacacagcgggtggcacatctgagtatgagaagctctgccgtgcccgg
gaccagtgccgagagattctcaagtttgtgaatgaagcagtgaagcagacagagaaccgt
caccgcttagaagggtaccagaaacgcctggatgccactgctctagagcgggccagcaac
cccttggcagcagagttcaagagcctggatcttacgacaaggaagatgatccacgagggg
cctctgacctggaggatcagcaaagataagaccctggacctccaggtgctgttactcgag
gacctggtagtgctgctgcagagacaagaggagaagctgctgctcaagtgccacagcaag
acagctgtgggctcctcagacagcaagcagaccttcagccctgtgctgaagctcaatgcc
gtgctcatccgctctgtggccacagataaacgagccttcttcatcatctgcacctccgag
ctgggccctccccagatctatgagctggttgcattgacatcatcagacaagaatatatgg
atggagctcttagaagaggctgtgcagaatgccaccaagcaccctggagatgccccagta
ctcaaccatccctcaccaccaggatcccaggagccagcctaccagggctccacctccagc
agggtagaggtgaatgactcggaagtgtatcccactgaaagagaacccaagaagccatct
gaaggccccgggcccgagcagagaggtcaagacaagcagctgctagcacaagaggggcct
gagcaggaggaggatgcagaggagctgagggccctgccttgccctcctccctccctggat
ggagaaaacagaggcatcaggacaagggaccctgtccttctggccctcacaggccctctg
ctcatggagggacttgctgatgctgccctggaagatgtggagaacttgcggcaccttatc
ctgtggagcctgctgcctggtcacactgtgaagactcaggctgctggcgagcctgaagat
gaccttacacccaccccttctgtcgtcagcattacctctcacccctgggacccaggatcc
ccagggcaagctcctgctataagtgacaacacccaatttccaaggccagagggaagccag
ccagagggcgaggatgttgctctctgttctctggcacacttgccaccaaggaccagaaat
tctggcatctgggactctcctgagctggataggaatccagctgaagaggcttcaagctca
gaaccagcaggaagttacaaagttgtaaggaaagtctctctactccctggtggtggtgtc
ggtgcagccaaggtggcgggcagcaatgttacccctgcactcccagagagtggccagtca
gaatctgagctatctgaagtggaaggcggagcacaggctacggggaactgtttctatgtc
agcatgccagcagaacctctggactctagcactgagcctcctgggacacccccaagtctc
tcgcagtgtcacagcctccctgcatggccaacagagcctccgcaacacaggggagtcact
gggggtcagcgttccagcctggtcctcagggatatgggtgtgatcttccacaccatcgag
caactgaccgtcaagcttcacagactcaaggacatggagctggcccacagagagctgctc
aactcccttggaggagagtcgtctggtggaaccactcctgtgggaagttttcacacagag
gcagccagatggacagactactccctctctcctccagccaaggaagccctgacctctgac
ccccaaaacaatcaggagcaggggtcctaccctgaagaaggctccgacacccccctggaa
gacagtgccacagacacagcttcgtcaccaggaccatag

DBGET integrated database retrieval system