KEGG   Mus musculus (mouse): 213499Help
Entry
213499            CDS       T01002                                 

Gene name
Fbxo42, 6720460I06Rik, mKIAA1332
Definition
(RefSeq) F-box protein 42
  KO
K10317  F-box protein 42
Organism
mmu  Mus musculus (mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:mmu04121]
    213499 (Fbxo42)
Ubiquitin system [BR:mmu04121]
 Ubiquitin ligases (E3)
  Multi subunit Ring-finger type E3
   SCF complex
    Target recognizing subunit (F-box)
     213499 (Fbxo42)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Kelch_4 Kelch_3 Kelch_5 Kelch_1 Kelch_2 Kelch_6 F-box-like F-box F-box_5
Motif
Other DBs
NCBI-GeneID: 213499
NCBI-ProteinID: NP_766106
MGI: 1924992
Ensembl: ENSMUSG00000028920
Vega: OTTMUSG00000010145
UniProt: Q6PDJ6
Position
4; 4 D3
AA seq 717 aa AA seqDB search
MASSSDSEDDSVMAVDQEETALEGTMEQDEDPHPVLEVEETRHNRSMSELPEEVLEYILS
FLSPYQEHKTAALVCKQWYRLIKGVAHQCYHGFMKAVQEGNIQWESRTYPYPGTPITQRF
SHSACYYDANQSMYVFGGCTQSSCNAAFNDLWRLDLNSKEWIRPLASGSYPSPKAGATLV
VYKDLLVLFGGWTRPSPYPLHQPERFFDEIHTYSPSKNWWNCIVTTHGPPPMAGHSSCVI
GDKMIVFGGSLGSRQMSNEVWVLDLEQWAWSKPNISGPSPHPRGGQSQIVIDDTTLLILG
GCGGPNALFKDAWLLHMHPGPWAWQPLKVENEDHGAPELWCHPACRVGQCVVVFSQAPSG
RAPLSPSLNSRPSPISATPPALVPETREYRSQSPVRSMDEAPCVNGRWGTLRPRAQRQTP
SGSREGSLSPARGDGSPILNGGNLSPGTVAVGGASLDSPVQVVSPSTPSASDGYDLKVGL
SLAPRRGSLPDQKDLRLSSIDLNWDLKSASSSSHVDSIDNRTVAGSVRHPPEQTNGVHTP
PHVASALAGAVSPGALRRSLEAIKAMSSKGPSASAALSPPLGSSPSSPGSQSLSSGETVP
NSRPGPAQGDGHSLPPIARRLGHHPPQSLNVGKPLYQSMNCKPMQMYVLDIKDTKEKGRV
KWKVFTSSSVVGPPETSLHTVVQGRGELIVFGGLMDKKQNVKYYPKTNALYFVRAKR
NT seq 2154 nt NT seq  +upstreamnt  +downstreamnt
atggccagctcctcggacagtgaagatgacagtgtcatggccgtggaccaagaagaaact
gcactggaagggacaatggagcaagatgaggacccccacccagtgttggaggttgaggaa
acaagacataataggtccatgtctgagctgccggaagaggttttggagtatattctgtcc
ttcctttcaccataccaggaacacaagactgcagctctggtctgcaaacagtggtatcga
cttatcaaaggtgtggcccaccagtgttaccatggcttcatgaaggctgtccaggaagga
aacattcagtgggagagccggacttacccttatccgggaacccctatcactcagcgcttc
tcccacagtgcgtgctattatgatgccaatcagtctatgtatgtctttggtggctgtacg
cagagcagttgcaatgctgccttcaatgacctctggaggctagacctaaatagcaaggag
tggattcgaccattggcctcagggtcctatccttcccccaaagctggggccactctggtc
gtgtacaaggacttgctagtgctatttggtggctggacaaggccaagtccctatccctta
caccagccagagagattctttgatgaaattcacacgtactcgccgtctaaaaactggtgg
aactgcattgtcaccacgcatgggcctcctcccatggctggccattcctcctgtgtgata
ggtgataaaatgattgtcttcggtggctccttaggatcccggcagatgagcaatgaagtc
tgggtcctggacctggagcagtgggcgtggtccaagccgaacatctctggccccagtcca
caccctcgaggtggccagtctcagattgttatagatgatacaactcttctgatccttggc
gggtgtggcggtcccaatgcgctgttcaaagatgcctggctgctgcacatgcacccaggt
ccctgggcctggcagccactcaaggtagaaaatgaagaccatggtgccccggagctatgg
tgtcatccagcctgccgggtgggacagtgtgtggtggtcttcagccaggcgccaagcggg
agagcgcccctcagccccagtttgaactctcgcccgtcacctatcagtgccactcctcca
gccctggttcctgagacccgagagtaccgctcccagtccccggtgaggagtatggacgaa
gcgccctgtgttaatggccgctggggaacactgaggcccagggctcaaaggcagactccc
tcgggttcccgggaagggagcctctccccagccagaggagatggctctcccattctcaat
ggtggaaatttgtctccagggacagtagctgtcgggggtgcttccttagacagccccgta
caggtcgtgtctccaagcactccatctgcctctgacggctacgacctaaaagtaggactt
tctctagctcctcgacgagggtctttaccagatcagaaggacctgaggttaagttccatt
gatctgaattgggacctgaagtctgcttccagtagtagtcacgtggatagtatagacaac
aggacagttgcagggagtgtgagacaccctccagaacagaccaatggtgttcacacccca
ccacatgtggccagtgcccttgcaggggctgtatctcccggtgccctgcgtcggagtttg
gaagccatcaaagcgatgtcatccaaaggcccctcagcctcggcagcactaagtcctcct
cttgggtcttctccaagctcccctgggagtcagagcctgagcagtggagaaacagtgccc
aactcccgcccaggaccagcccaaggagatggtcattccttacccccgattgctcggcgc
ctgggccaccaccctccacagtcccttaatgtgggtaaacccttgtaccagagtatgaac
tgcaaacctatgcagatgtatgtgctagacattaaagacaccaaggagaagggccgagtc
aagtggaaagtgttcacaagcagctcggtggtcgggcctcctgagaccagcctgcacacg
gtggtgcagggccgaggcgagctcatcgtatttggagggctcatggacaagaagcagaat
gtgaagtactacccaaagacaaacgccttgtactttgtgcgcgcaaagagataa

DBGET integrated database retrieval system